Align Serine O-succinyltransferase; SST; Homoserine O-succinyltransferase; HST; Homoserine transsuccinylase; HTS; EC 2.3.1.-; EC 2.3.1.46 (characterized)
to candidate Pf6N2E2_4597 Homoserine O-acetyltransferase (EC 2.3.1.31)
Query= SwissProt::S2KHP1 (367 letters) >FitnessBrowser__pseudo6_N2E2:Pf6N2E2_4597 Length = 363 Score = 247 bits (631), Expect = 3e-70 Identities = 138/354 (38%), Positives = 203/354 (57%), Gaps = 5/354 (1%) Query: 13 PVRMYRGGELPSVTIAYETWGELRGQGDNALLLFTGLSPSAHAAS--SMADPSPGWWEYM 70 P+ + G LP+ + YET+G L NA+L+ LS HAA S+ D PGWW+ Sbjct: 7 PLALACGRSLPAYDLIYETYGTLNATASNAVLICHALSGHHHAAGYHSVDDRKPGWWDSC 66 Query: 71 IGPGKPIDTERFFVIAINSLGSCFGSTGPASINPATGQPYRLDFPKLSVEDIVAAARGAC 130 IGPGKPIDT +FFV+++N+LG C GSTGP+S+NP TG+P+ DFP L+VED V + Sbjct: 67 IGPGKPIDTSKFFVVSLNNLGGCNGSTGPSSLNPDTGKPFGADFPVLTVEDWVHSQARLA 126 Query: 131 RALGIDHVHTVAGASLGGMDALAYAVMYPGTYRDIISISAAAHATPFTIALRSIQREAVR 190 LGI V G SLGGM AL + + YP R ++I++A + IA + R+A+ Sbjct: 127 DRLGIGQWAAVIGGSLGGMQALQWTITYPDRVRHCLAIASAPKLSAQNIAFNEVARQAIL 186 Query: 191 ADPAWAGGNYAP-GEGPKDGMRVARQLGILTYRSAEEWLQRFDRERLEGSDDSANPFAMA 249 DP + GG++ G PK G+ +AR +G +TY S + ++F R L+ + + ++ Sbjct: 187 TDPEFHGGSFQEHGVIPKRGLMLARMVGHITYLSDDSMGEKFGR-GLKSEKLNYDFHSVE 245 Query: 250 FQVQSYMEANARKFADRFDANCYLYLSQAMDLFDMAEHGDGSLEAAVRRIDAKRALVAGV 309 FQV+SY+ +F+ RFDAN YL +++A+D FD A + D +L AK V Sbjct: 246 FQVESYLRYQGEEFSGRFDANTYLLMTKALDYFDPAANFDDNLAKTFANATAK-FCVMSF 304 Query: 310 TTDWLFPLWQQRQVAELLEHAGVAVSYHELGSIQGHDAFLVDSERFAPMVAEFL 363 TTDW F + R++ + L A V Y E+ + QGHDAFL+ R+ ++ Sbjct: 305 TTDWRFSPARSRELVDALMAARKDVCYLEIDAPQGHDAFLIPIPRYLQAFGNYM 358 Lambda K H 0.320 0.135 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 365 Number of extensions: 23 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 367 Length of database: 363 Length adjustment: 30 Effective length of query: 337 Effective length of database: 333 Effective search space: 112221 Effective search space used: 112221 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory