Align phosphoserine aminotransferase; EC 2.6.1.52 (characterized)
to candidate Pf6N2E2_2521 Phosphoserine aminotransferase (EC 2.6.1.52)
Query= CharProtDB::CH_002572 (362 letters) >FitnessBrowser__pseudo6_N2E2:Pf6N2E2_2521 Length = 363 Score = 406 bits (1043), Expect = e-118 Identities = 202/358 (56%), Positives = 252/358 (70%), Gaps = 2/358 (0%) Query: 5 FNFSSGPAMLPAEVLKQAQQELRDWNGLGTSVMEVSHRGKEFIQVAEEAEKDFRDLLNVP 64 +NF +GPA LP VLK+AQ EL DW+G G SVME+SHR EF+ +A +AE+D RDLLN+P Sbjct: 8 YNFCAGPAALPEAVLKRAQGELLDWHGKGLSVMEMSHRSDEFVSIATKAEQDLRDLLNIP 67 Query: 65 SNYKVLFCHGGGRGQFAAVPLNILGDKTTADYVDAGYWAASAIKEAKKYCTPNVFDAKVT 124 SNYKVLF GG QFA +PLN+L + ADY+D G W+ AI+EA +Y NV Sbjct: 68 SNYKVLFLQGGASQQFAQIPLNLLPESGKADYIDTGIWSQKAIEEASRYGHVNVAATAKP 127 Query: 125 VDGLRAVKPMREWQLSDNAAYMHYCPNETIDGIAIDETPDFGADVVVAADFSSTILSRPI 184 D A+ EW LS +AAY+HY PNETI G+ + P+ G DV + AD SS ILSRP+ Sbjct: 128 YDYF-AIPGQNEWNLSKDAAYVHYAPNETIGGLEFNWIPETG-DVPLVADMSSDILSRPV 185 Query: 185 DVSRYGVIYAGAQKNIGPAGLTIVIVREDLLGKANIACPSILDYSILNDNGSMFNTPPTF 244 D+SR+G+IYAGAQKNIGP+G+ + I+REDLLG+A CP++L+Y + DNGSM+NTPPT Sbjct: 186 DISRFGMIYAGAQKNIGPSGILVSIIREDLLGRARSLCPTMLNYKVAADNGSMYNTPPTL 245 Query: 245 AWYLSGLVFKWLKANGGVAEMDKINQQKAELLYGVIDNSDFYRNDVAKANRSRMNVPFQL 304 AWYLSGLVF+WLK GGV + K+N+ K LY ID S Y N + K +RS MNVPF+L Sbjct: 246 AWYLSGLVFEWLKEQGGVEAIGKLNEVKQRTLYDFIDASGLYSNPINKTDRSWMNVPFRL 305 Query: 305 ADSALDKLFLEESFAAGLHALKGHRVVGGMRASIYNAMPLEGVKALTDFMVEFERRHG 362 AD LDK FL + GL LKGHR VGGMRASIYNA+ + V AL +M EFE+ HG Sbjct: 306 ADDRLDKPFLAGADERGLLNLKGHRSVGGMRASIYNAVDINAVNALIAYMAEFEKEHG 363 Lambda K H 0.319 0.136 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 417 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 362 Length of database: 363 Length adjustment: 29 Effective length of query: 333 Effective length of database: 334 Effective search space: 111222 Effective search space used: 111222 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate Pf6N2E2_2521 (Phosphoserine aminotransferase (EC 2.6.1.52))
to HMM TIGR01364 (serC: phosphoserine transaminase (EC 2.6.1.52))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01364.hmm # target sequence database: /tmp/gapView.20369.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01364 [M=358] Accession: TIGR01364 Description: serC_1: phosphoserine transaminase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-164 533.2 0.0 1.5e-164 533.0 0.0 1.0 1 lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_2521 Phosphoserine aminotransferase ( Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_2521 Phosphoserine aminotransferase (EC 2.6.1.52) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 533.0 0.0 1.5e-164 1.5e-164 2 358 .] 8 362 .. 7 362 .. 0.99 Alignments for each domain: == domain 1 score: 533.0 bits; conditional E-value: 1.5e-164 TIGR01364 2 vnFsaGPaalpeevlekaqkelldfnglglsvmeisHRskefekvveeaesdlreLlnipdnye 65 +nF+aGPaalpe+vl++aq elld++g+glsvme+sHRs+ef +++++ae+dlr+Llnip+ny+ lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_2521 8 YNFCAGPAALPEAVLKRAQGELLDWHGKGLSVMEMSHRSDEFVSIATKAEQDLRDLLNIPSNYK 71 8*************************************************************** PP TIGR01364 66 vlflqGGattqfaavplnllkekkvadyivtGawskkalkeakkltkevkvvaseeekkyskip 129 vlflqGGa++qfa++plnll e+ +adyi tG ws+ka++ea+++++ v+v+a+++ +y +ip lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_2521 72 VLFLQGGASQQFAQIPLNLLPESGKADYIDTGIWSQKAIEEASRYGH-VNVAATAKPYDYFAIP 134 *********************************************99.**************** PP TIGR01364 130 deeelelkedaayvylcanetieGvefkelpevkkaplvaDlssdilsrkidvskygliyaGaq 193 ++e++l++daayv+++ neti G+ef+++pe+ ++plvaD+ssdilsr++d+s++g+iyaGaq lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_2521 135 GQNEWNLSKDAAYVHYAPNETIGGLEFNWIPETGDVPLVADMSSDILSRPVDISRFGMIYAGAQ 198 **************************************************************** PP TIGR01364 194 KniGpaGvtvvivrkdllerakkelpsvldYkilaendslyntpptfaiyvlglvlkwlkekGG 257 KniGp+G+ v i+r+dll+ra++ +p++l+Yk++a+n s+yntppt a+y++glv++wlke+GG lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_2521 199 KNIGPSGILVSIIREDLLGRARSLCPTMLNYKVAADNGSMYNTPPTLAWYLSGLVFEWLKEQGG 262 **************************************************************** PP TIGR01364 258 vkklekknqeKakllYeaidesegfyknkvekkaRslmnvvFtlkkeelekeFlkeaeekglvs 321 v+++ k n+ K + lY+ id+s g+y n+++k++Rs+mnv+F+l++++l+k Fl+ a e+gl++ lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_2521 263 VEAIGKLNEVKQRTLYDFIDAS-GLYSNPINKTDRSWMNVPFRLADDRLDKPFLAGADERGLLN 325 ********************99.6**************************************** PP TIGR01364 322 lkGhrsvGGiRasiYnalpleevqaLvdfmkeFekkh 358 lkGhrsvGG+RasiYna+ +++v+aL+++m eFek+h lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_2521 326 LKGHRSVGGMRASIYNAVDINAVNALIAYMAEFEKEH 362 **********************************997 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (358 nodes) Target sequences: 1 (363 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 7.55 // [ok]
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory