Align Putative ribose-phosphate pyrophosphokinase 2; RPPK 2; 5-phospho-D-ribosyl alpha-1-diphosphate synthase 2; Phosphoribosyl diphosphate synthase 2; Phosphoribosyl pyrophosphate synthase 2; P-Rib-PP synthase 2; PRPP synthase 2; PRPPase 2; EC 2.7.6.1 (characterized)
to candidate Pf6N2E2_844 Ribose-phosphate pyrophosphokinase (EC 2.7.6.1)
Query= SwissProt::Q5XC85 (326 letters) >FitnessBrowser__pseudo6_N2E2:Pf6N2E2_844 Length = 330 Score = 147 bits (371), Expect = 4e-40 Identities = 97/304 (31%), Positives = 155/304 (50%), Gaps = 17/304 (5%) Query: 12 LFSLTSNLPIAEKIAKAAGIPLGKMSSRQFSDGEIMINIEETVRGDDIYIIQST----SF 67 LF+L A ++A G PL + R + DGE + V G ++ + S Sbjct: 8 LFALQGCEHYAARVAHRLGCPLARHEERDYEDGEHKCRPLDPVNGREVVVFHSLYGDGRQ 67 Query: 68 PVNDNLWELLIMIDACKRASANTVNIVLPYFGYSRQDRVAKPREPITAKLVANMLTKAGI 127 ND L LL A K A A V +V PY Y R+DR ++P++P + VA+ +G+ Sbjct: 68 SANDKLCRLLFFCGALKDAGARQVQVVCPYLCYGRKDRRSQPQDPTITRYVASFFEASGV 127 Query: 128 DRVVTLDLH-AVQVQGFFDIPVDNLFTVPLFAERYSKLGLSGSDVVVVSPKNSGIKRARS 186 DR++TLD+H F +P NL LFAE ++ + + VVVVSP + G KRA Sbjct: 128 DRLLTLDVHNPAAFDNAFRLPAWNLQCAQLFAEHFA-TQVGDAAVVVVSPDSGGTKRAEH 186 Query: 187 LAEYLDSPI------AIIDYAQDDSEREQGYIIGDVSGKKAILIDDILNTGKTFAEAAKI 240 + L+ + A+++ + + ++GDV+GK AI+ DD+++TG T A Sbjct: 187 FRQALEWQLGRTVGSALMEKHRTQNTLTGSLLLGDVAGKTAIVFDDLISTGDTLKRAGLA 246 Query: 241 LERSGATDTYAVASHGLFAGGAAEVLETAPIKEIIVTDSVKTKNRVPENVT----YLSAS 296 +++GAT +A A+HGLF G +++ + + I +TD+V P+ VT L ++ Sbjct: 247 CQKAGATRLFAAATHGLFTTG-SQLFDPPIFERIAITDTVAPFRLPPDCVTQHLQVLDST 305 Query: 297 DLIA 300 LIA Sbjct: 306 GLIA 309 Lambda K H 0.317 0.134 0.371 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 207 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 326 Length of database: 330 Length adjustment: 28 Effective length of query: 298 Effective length of database: 302 Effective search space: 89996 Effective search space used: 89996 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
Align candidate Pf6N2E2_844 (Ribose-phosphate pyrophosphokinase (EC 2.7.6.1))
to HMM TIGR01251 (prs: ribose-phosphate diphosphokinase (EC 2.7.6.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01251.hmm # target sequence database: /tmp/gapView.21083.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01251 [M=309] Accession: TIGR01251 Description: ribP_PPkin: ribose-phosphate diphosphokinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.9e-64 202.9 0.0 3.7e-64 202.5 0.0 1.0 1 lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_844 Ribose-phosphate pyrophosphokina Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_844 Ribose-phosphate pyrophosphokinase (EC 2.7.6.1) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 202.5 0.0 3.7e-64 3.7e-64 4 295 .. 9 312 .. 7 317 .. 0.90 Alignments for each domain: == domain 1 score: 202.5 bits; conditional E-value: 3.7e-64 TIGR01251 4 lsgssskelaekvaknlglelgdvevkkFadgElyvrieesvrgkdvfiiv...qstsapvndal 65 ++++ ++ a++va++lg +l + e + + dgE + r + v+g++v+++ ++ nd+l lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_844 9 FALQGCEHYAARVAHRLGCPLARHEERDYEDGEHKCRPLDPVNGREVVVFHslyGDGRQSANDKL 73 777888999**************************************99975554566789**** PP TIGR01251 66 mellllidalkrasaksvtaviPyygYaRqdkkaksrepisaklvaklleeaGadrvltvdlHse 130 ll+ + alk+a+a++v++v Py+ Y+R+d++ ++ +p + va+++e+ G+dr+lt+d+H++ lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_844 74 CRLLFFCGALKDAGARQVQVVCPYLCYGRKDRRSQPQDPTITRYVASFFEASGVDRLLTLDVHNP 138 ****************************************************************8 PP TIGR01251 131 q.iqgfFdvpvenlsaspklieelkkke.lknlvvvsPDkGaverakkvakklglel......ai 187 + ++F+ p+ nl+ ++ ++e+++ ++ + +vvvsPD+G+++ra++++++l+ +l a+ lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_844 139 AaFDNAFRLPAWNLQCAQLFAEHFATQVgDAAVVVVSPDSGGTKRAEHFRQALEWQLgrtvgsAL 203 62689*********************999999*******************99866544444489 PP TIGR01251 188 ieKeRdskenevevtnllgdvegkdvvivDDiisTggTlvkaaelLkekGAkkvivaathgvfsg 252 +eK+R +n+ + llgdv+gk+++++DD+isTg Tl +a + +++GA++ ++aathg+f+ lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_844 204 MEKHRT--QNTLTGSLLLGDVAGKTAIVFDDLISTGDTLKRAGLACQKAGATRLFAAATHGLFTT 266 ******..779****************************************************97 PP TIGR01251 253 dAlerlaeagveevivtntilv.ee...kklpkvseisvapliaeai 295 + + ++ +e++++t+t++ + ++++++++ + lia + lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_844 267 GS-QLFDPPIFERIAITDTVAPfRLppdCVTQHLQVLDSTGLIATFL 312 65.889**************864323334556677777777777666 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (309 nodes) Target sequences: 1 (330 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 7.76 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory