Align 3-isopropylmalate dehydrogenase; 3-IPM-DH; IMDH; EC 1.1.1.85; Beta-IPM dehydrogenase (uncharacterized)
to candidate Pf6N2E2_289 Isocitrate dehydrogenase [NADP] (EC 1.1.1.42)
Query= curated2:O29627 (326 letters) >FitnessBrowser__pseudo6_N2E2:Pf6N2E2_289 Length = 418 Score = 140 bits (352), Expect = 7e-38 Identities = 113/383 (29%), Positives = 181/383 (47%), Gaps = 69/383 (18%) Query: 4 IVVIPGDGIGKEVMEAAMLILEKLDLPFEYSYYD----------AGDEALEKYGKA--LP 51 I I GDGIG ++ + ++++ +D + +Y AG++A + Y + LP Sbjct: 31 IPFIEGDGIGVDI---SPVMIKVVDAAVQKAYGGKRKISWMEVYAGEKATQVYDQDTWLP 87 Query: 52 DETLEACRKSDAVLFGA----AGETAADVIVRLRRELGTFANVRPAKAIEGIECLY--PG 105 ETL+A + + G G + V LR++L + +RP + EG+ PG Sbjct: 88 QETLDAVKDYVVSIKGPLTTPVGGGIRSLNVALRQQLDLYVCLRPVRWFEGVPSPVKKPG 147 Query: 106 -LDIVVVRENTECLYMGFEF--GFGDVTEAIRV----------------------ITREA 140 +D+ + REN+E +Y G E+ G + T+ I+ ++++ Sbjct: 148 DVDMTIFRENSEDIYAGIEWKAGSAEATKVIKFLKEEMGVTKIRFDEDCGIGVKPVSKQG 207 Query: 141 SERIARYAFELAKREGRKKVTALHKANVMKKTCGLFRDVCREVAKDY---------PEIQ 191 ++R+AR A + R +T +HK N+MK T G F++ EVA + P +Q Sbjct: 208 TKRLARKALQYVVDNDRDSLTIVHKGNIMKFTEGAFKEWAYEVAAEEFGATLLDGGPWMQ 267 Query: 192 YN-----------DYYIDAACMYLVMDPFRFDVIVTTNMFGDIVSDLAAGLVGGLGLAPS 240 + D DA +++ P +DVI T N+ GD +SD A VGG+G+AP Sbjct: 268 FKNPKTGKNVIVKDAIADAMLQQILLRPAEYDVIATLNLNGDYLSDALAAEVGGIGIAPG 327 Query: 241 ANVGERTAIFEPVHGAAFDIAGKGIANPTAMILTACMMLRHFGYVEEAKKVEEAVEKTIK 300 AN+ + A+FE HG A AGK NP ++IL+A MMLRH G+ E A + + I Sbjct: 328 ANLSDTVAMFEATHGTAPKYAGKDQVNPGSLILSAEMMLRHMGWTEAADLIIKGTNGAIS 387 Query: 301 EGKKTPDLGGNLKTMEFANEVAS 323 T D + ME A V+S Sbjct: 388 AKTVTYDFE---RLMEGAKLVSS 407 Lambda K H 0.321 0.139 0.399 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 285 Number of extensions: 12 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 326 Length of database: 418 Length adjustment: 30 Effective length of query: 296 Effective length of database: 388 Effective search space: 114848 Effective search space used: 114848 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory