GapMind for Amino acid biosynthesis


Aligments for a candidate for dapC in Pseudomonas fluorescens FW300-N2E2

Align phosphoserine aminotransferase; EC (characterized)
to candidate Pf6N2E2_2521 Phosphoserine aminotransferase (EC

Query= CharProtDB::CH_002572
         (362 letters)

          Length = 363

 Score =  406 bits (1043), Expect = e-118
 Identities = 202/358 (56%), Positives = 252/358 (70%), Gaps = 2/358 (0%)


           SNYKVLF  GG   QFA +PLN+L +   ADY+D G W+  AI+EA +Y   NV      

            D   A+    EW LS +AAY+HY PNETI G+  +  P+ G DV + AD SS ILSRP+


           AWYLSGLVF+WLK  GGV  + K+N+ K   LY  ID S  Y N + K +RS MNVPF+L

           AD  LDK FL  +   GL  LKGHR VGGMRASIYNA+ +  V AL  +M EFE+ HG

Lambda     K      H
   0.319    0.136    0.405 

Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 417
Number of extensions: 11
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 362
Length of database: 363
Length adjustment: 29
Effective length of query: 333
Effective length of database: 334
Effective search space:   111222
Effective search space used:   111222
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 49 (23.5 bits)

Align candidate Pf6N2E2_2521 (Phosphoserine aminotransferase (EC
to HMM TIGR01364 (serC: phosphoserine transaminase (EC

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020);
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.aa/TIGR01364.hmm
# target sequence database:        /tmp/gapView.28967.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR01364  [M=358]
Accession:   TIGR01364
Description: serC_1: phosphoserine transaminase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                      -----------
   1.3e-164  533.2   0.0   1.5e-164  533.0   0.0    1.0  1  lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_2521  Phosphoserine aminotransferase (

Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_2521  Phosphoserine aminotransferase (EC
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  533.0   0.0  1.5e-164  1.5e-164       2     358 .]       8     362 ..       7     362 .. 0.99

  Alignments for each domain:
  == domain 1  score: 533.0 bits;  conditional E-value: 1.5e-164
                                      TIGR01364   2 vnFsaGPaalpeevlekaqkelldfnglglsvmeisHRskefekvveeaesdlreLlnipdnye 65 
                                                    +nF+aGPaalpe+vl++aq elld++g+glsvme+sHRs+ef +++++ae+dlr+Llnip+ny+
                                                    8*************************************************************** PP

                                      TIGR01364  66 vlflqGGattqfaavplnllkekkvadyivtGawskkalkeakkltkevkvvaseeekkyskip 129
                                                    vlflqGGa++qfa++plnll e+ +adyi tG ws+ka++ea+++++ v+v+a+++  +y +ip
                                                    *********************************************99.**************** PP

                                      TIGR01364 130 deeelelkedaayvylcanetieGvefkelpevkkaplvaDlssdilsrkidvskygliyaGaq 193
                                                     ++e++l++daayv+++ neti G+ef+++pe+ ++plvaD+ssdilsr++d+s++g+iyaGaq
                                                    **************************************************************** PP

                                      TIGR01364 194 KniGpaGvtvvivrkdllerakkelpsvldYkilaendslyntpptfaiyvlglvlkwlkekGG 257
                                                    KniGp+G+ v i+r+dll+ra++ +p++l+Yk++a+n s+yntppt a+y++glv++wlke+GG
                                                    **************************************************************** PP

                                      TIGR01364 258 vkklekknqeKakllYeaidesegfyknkvekkaRslmnvvFtlkkeelekeFlkeaeekglvs 321
                                                    v+++ k n+ K + lY+ id+s g+y n+++k++Rs+mnv+F+l++++l+k Fl+ a e+gl++
                                                    ********************99.6**************************************** PP

                                      TIGR01364 322 lkGhrsvGGiRasiYnalpleevqaLvdfmkeFekkh 358
                                                    lkGhrsvGG+RasiYna+ +++v+aL+++m eFek+h
  lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_2521 326 LKGHRSVGGMRASIYNAVDINAVNALIAYMAEFEKEH 362
                                                    **********************************997 PP

Internal pipeline statistics summary:
Query model(s):                            1  (358 nodes)
Target sequences:                          1  (363 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.02u 0.00s 00:00:00.02 Elapsed: 00:00:00.01
# Mc/sec: 7.79

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.



Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory