Align O-acetylhomoserine sulfhydrylase (EC:2.5.1.49) (characterized)
to candidate Pf6N2E2_4958 Cystathionine gamma-synthase (EC 2.5.1.48)
Query= reanno::Korea:Ga0059261_3194 (402 letters) >FitnessBrowser__pseudo6_N2E2:Pf6N2E2_4958 Length = 417 Score = 248 bits (633), Expect = 2e-70 Identities = 143/396 (36%), Positives = 219/396 (55%), Gaps = 4/396 (1%) Query: 8 DRSITQNWKPATQAIRGGT-ARSEWGETSEALFLTSGYAYDCAGDAAARFSGDQQGMTYS 66 D + N T+A+ GG R + T + ++ Y YD G G YS Sbjct: 6 DSTGLDNAGAGTRAVWGGEQVRHPYNATQTPIVASAAYGYDDIDVWYDVALGKAPGFIYS 65 Query: 67 RLQNPTVEMLEQRIALLEGAEACRATASGMAAMTAALLCQLSAGDHLIGGRAAFGSCRWL 126 R+ NPTVE LE +I LE AE+ A +SGMAA+++ L L+ GD ++ + ++G + Sbjct: 66 RMSNPTVETLEAKIRELEMAESAVAFSSGMAAISSVLYTFLAHGDRVVSTKDSYGGTNKI 125 Query: 127 TDTQLPKFGIETTVVDARDPQQFIDAIRPNTKVFFFETPANPTMDVVDLKAVCAIARERG 186 + LP+ G+ T+ + D I +V + ETP NPT+ ++D+ + A A+ G Sbjct: 126 FEEFLPRTGVAVTLCETFDHDDLEREIAKGCQVLYLETPTNPTLKILDIPRLVAAAKRVG 185 Query: 187 IVTVVDNAFATPALQRPMDFGADVVAYSATKMMDGQGRVLAGAVCGTEEFINNTLLPFHR 246 V V DN FATP Q P+ G DVV +SATK + G G VL G VCG+E + + + Sbjct: 186 AVVVADNTFATPLNQSPLALGVDVVIHSATKFLSGHGDVLGGLVCGSEALMAQ-VRHYRE 244 Query: 247 NTGPTLSPFNAWVVLKGLETLDLRIQRQSENALKVARFL--EGRVPRVNFPGLPSHPQHN 304 G +L PF+A+++++G++TL LR+++Q +A +A FL E V VN+PGLPSHP H Sbjct: 245 INGASLDPFSAYLIIRGMKTLALRMRQQQHSARALAEFLCTEPLVEAVNYPGLPSHPNHA 304 Query: 305 LAMSQMAAAGPIFSIELDGGRTQAHGLLDALGLIDISNNIGDSRSLMTHPASTTHSGVAE 364 +A +QM+ G I S L GG LL L + N+G ++ +T+H Sbjct: 305 VACAQMSGFGAIVSFVLVGGMDTVKLLLPRLRFAHCAGNLGAVETIYGPARTTSHVENTL 364 Query: 365 DQRLLMGVGEGMLRLNVGLEDPEDLIADLDQALGSV 400 ++RL +G+ EG++R++VG+ED +DL+ DL QA V Sbjct: 365 EERLALGISEGLVRVSVGIEDTDDLLDDLKQAFAFV 400 Lambda K H 0.319 0.134 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 378 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 402 Length of database: 417 Length adjustment: 31 Effective length of query: 371 Effective length of database: 386 Effective search space: 143206 Effective search space used: 143206 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory