Align phosphoglycerate dehydrogenase (EC 1.1.1.95) (characterized)
to candidate Pf6N2E2_627 2-ketogluconate 6-phosphate reductase (EC 1.1.1.43)
Query= BRENDA::P9WNX3 (528 letters) >FitnessBrowser__pseudo6_N2E2:Pf6N2E2_627 Length = 325 Score = 201 bits (511), Expect = 3e-56 Identities = 122/321 (38%), Positives = 182/321 (56%), Gaps = 9/321 (2%) Query: 6 VLIADKLAPSTVAALGDQVEVRWVDGPDRDKLLA---AVPEADALLVRSATTVDAEVLAA 62 V++ L+ +A L Q +V ++ D L+ A+P A LL S +DA +L Sbjct: 5 VVLYKALSAQLMARLQAQAQVTLIERLDAQGLVQLREALPSAHGLLGASLK-LDAPLLDL 63 Query: 63 APKLKIVARAGVGLDNVDVDAATARGVLVVNAPTSNIHSAAEHALALLLAASRQIPAADA 122 AP L+ +A VG+DN D+D T R +L+ N P + A+ AL+LA +R++ Sbjct: 64 APNLQAIASVSVGVDNYDIDYLTERRILLTNTPDVLTETTADTGFALILATARRVVELAN 123 Query: 123 SLREHTWKRS---SFSGTEIFGKTVGVVGLGRIGQLVAQR-IAAFGAYVVAYDPYVSPAR 178 +R W++S GT++ GKT+G++G+GRIG+ +AQR FG V+ + PA Sbjct: 124 LVRSGGWQQSIGPRHFGTDVHGKTLGIIGMGRIGEALAQRGHFGFGMQVIYHSHSPKPAV 183 Query: 179 AAQLGIELLSLDDLLARADFISVHLPKTPETAGLIDKEALAKTKPGVIIVNAARGGLVDE 238 + SL+ LL +ADF+ + LP T ET GLID +A A+ +P I +N +RG +VDE Sbjct: 184 EQRFNARYCSLETLLQQADFVCLTLPLTAETQGLIDAQAFARMRPESIFINISRGKVVDE 243 Query: 239 AALADAITGGHVRAAGLDVFATEPCT-DSPLFELAQVVVTPHLGASTAEAQDRAGTDVAE 297 AL DA+ G +R AGLDVF EP + DSPL +L VV TPH+G++T E ++ + Sbjct: 244 TALIDALRNGQIRGAGLDVFEREPLSADSPLLQLDNVVATPHMGSATHETREAMARCAVD 303 Query: 298 SVRLALAGEFVPDAVNVGGGV 318 ++ ALAGE + VN G V Sbjct: 304 NLLAALAGERPVNLVNAGAWV 324 Lambda K H 0.317 0.133 0.370 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 372 Number of extensions: 18 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 528 Length of database: 325 Length adjustment: 31 Effective length of query: 497 Effective length of database: 294 Effective search space: 146118 Effective search space used: 146118 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory