Align Phosphoserine phosphatase; PSP; EC 3.1.3.3 (characterized)
to candidate Pf6N2E2_4415 Putative FMN hydrolase (EC 3.1.3.-); 5-Amino-6-(5'-phosphoribitylamino)uracil phosphatase
Query= SwissProt::Q72H00 (249 letters) >FitnessBrowser__pseudo6_N2E2:Pf6N2E2_4415 Length = 234 Score = 97.8 bits (242), Expect = 2e-25 Identities = 81/256 (31%), Positives = 119/256 (46%), Gaps = 48/256 (18%) Query: 1 MKLLLLDLDDTLLQDLPVSRAVLEDLGRKAGVEGFFARVKARAEALFREAPFYPW----A 56 ++L+ DLDDTL PV A AEA+ R+ W A Sbjct: 3 IELITFDLDDTLWDTAPVI---------------------ASAEAILRQ-----WLTDNA 36 Query: 57 EAIGHSALEALWA-----RYSTPGLEALAAWAGPFRERVFREALEEAGGAPERARELA-- 109 +G +E L++ PGL+ + R RV AL+EAG +A ELA Sbjct: 37 PNLGGVPVEHLFSIREQVLREEPGLKHRIS---ALRRRVLFRALQEAGYDQWQASELADQ 93 Query: 110 --EAFFRERRRYPLYPEAEAFLAEARRRGLALALLTNGVPDLQREKLVGAGLAHHFSLVL 167 E F R + ++PE + L E AL ++TNG D++R GLA +F L Sbjct: 94 AFETFLHARHQLEIFPEVQPTL-EILANHFALGVVTNGNADVRR-----LGLADYFKFAL 147 Query: 168 ISGEVGIGKPDPRLFRMALCAFGVAPEEAAMVGDNPQKDVRGARLAGVRAVWVDRGLRPE 227 + ++GI KPD RLF AL G + A +GD+P D+ GA+ AG+RAVW + + Sbjct: 148 CAEDIGIAKPDARLFHEALLRGGATAQTAVHIGDHPGDDIAGAQQAGLRAVWFNPTGKAW 207 Query: 228 DPEASPDLRVGDLREV 243 + + +PD + L E+ Sbjct: 208 EADHAPDAEIRSLTEL 223 Lambda K H 0.322 0.140 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 144 Number of extensions: 6 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 249 Length of database: 234 Length adjustment: 23 Effective length of query: 226 Effective length of database: 211 Effective search space: 47686 Effective search space used: 47686 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory