Align NAD(+)-dependent homoserine dehydrogenase; NAD(+)-dependent HSD; NgHSD; EC 1.1.1.3 (characterized)
to candidate Pf6N2E2_3143 Homoserine dehydrogenase (EC 1.1.1.3)
Query= SwissProt::Q5F8J4 (435 letters) >FitnessBrowser__pseudo6_N2E2:Pf6N2E2_3143 Length = 434 Score = 496 bits (1278), Expect = e-145 Identities = 251/435 (57%), Positives = 322/435 (74%), Gaps = 2/435 (0%) Query: 1 MKPVNIGLLGLGTVGGGAAAVLRDNAEEISRRLGREIRISAMCDLSEEKARQICPSAAFV 60 + PV +G+ GLGTVGGG VL+ NAEEI+RR GR I ++ + + K + A Sbjct: 1 VNPVKVGICGLGTVGGGTFNVLQRNAEEIARRAGRGIEVAQIA-MRTPKPQFQTTGIAIT 59 Query: 61 KDPFELVARKDVDVVVELFGGTGIAKEAVLKAIENGKHIVTANKKLLAEYGNEIFPLAEK 120 D FE+ ++D+V+EL GG +A+E VLKAIENGKH+VTANK L+A +GNEIF A + Sbjct: 60 NDVFEVATNPEIDIVIELVGGYTVARELVLKAIENGKHVVTANKALIAVHGNEIFAKARE 119 Query: 121 QNVIVQFEAAVAGGIPIIKALREGLAANRIKSIAGIINGTSNFILSEMREKGSAFADVLK 180 + VIV FEAAVAGGIP+IKA+REGL+ANRI +AGIINGT NFIL+EMREKG F DVL Sbjct: 120 KGVIVAFEAAVAGGIPVIKAIREGLSANRINWVAGIINGTGNFILTEMREKGRTFEDVLA 179 Query: 181 EAQALGYAEADPTFDIEGNDAGHKITIMSALAFGTPMNFSACYLEGISKLDSRDIKYAEE 240 EAQALGYAEADPTFD+EG DA HK+TI++++AFG P+ F Y EGI+KL + D+ YAE Sbjct: 180 EAQALGYAEADPTFDVEGIDAAHKLTILASIAFGIPLQFDKAYTEGITKLTTADVNYAEA 239 Query: 241 LGYRIKLLGVTRKTGKGIELRVHPTLIPESRLLANVDGVMNAVRVNADMVGETLYYGAGA 300 LGYRIK LGV R T GIELRVHPTLIP RL+ANV+GVMNAV VN D G TL+YGAGA Sbjct: 240 LGYRIKHLGVARSTANGIELRVHPTLIPADRLIANVNGVMNAVMVNGDASGSTLFYGAGA 299 Query: 301 GALPTASAVVADIIDIARLVEADTAHRVPHLAFQPAQVQAQTILPMDEITSSYYLRVQAK 360 G PTAS+V+AD++D+ R + +D +RVPHLAFQP + A ILP++ SSYYLR+QAK Sbjct: 300 GMEPTASSVIADLVDVVRAMTSDPENRVPHLAFQPDSLSAHPILPIEACESSYYLRIQAK 359 Query: 361 DEPGTLGQIAALLAQENVSIEALIQKGVIDQT-TAEIVILTHSTVEKHIKSAIAAIEALD 419 D PG L Q+A++L++ ++IE+++QK V + +++LTH VE+ I AIAA+EAL Sbjct: 360 DHPGVLAQVASILSERGINIESIMQKEVEEHDGLVPMILLTHRVVEQRINDAIAALEALQ 419 Query: 420 CVEKPITMIRMESLH 434 V P+ IR+E L+ Sbjct: 420 GVVGPVVRIRVEHLN 434 Lambda K H 0.318 0.135 0.369 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 532 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 435 Length of database: 434 Length adjustment: 32 Effective length of query: 403 Effective length of database: 402 Effective search space: 162006 Effective search space used: 162006 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory