Align Tryptophan synthase alpha chain; EC 4.2.1.20 (characterized, see rationale)
to candidate Pf6N2E2_4047 Tryptophan synthase alpha chain (EC 4.2.1.20)
Query= uniprot:H0BV16 (269 letters) >FitnessBrowser__pseudo6_N2E2:Pf6N2E2_4047 Length = 270 Score = 227 bits (578), Expect = 2e-64 Identities = 122/271 (45%), Positives = 171/271 (63%), Gaps = 9/271 (3%) Query: 1 MSRIASTFSALQAQGRKALIPYVTAGFPFADITPALMHGMVEAGADVIELGVPFSDPMAD 60 MSR+ + F+ L+ Q R AL+ +VTAG P D + A++ G+ AGADVIELG+PF+DPMAD Sbjct: 1 MSRLQTRFAELKEQNRAALVTFVTAGDPDYDTSLAILKGLPAAGADVIELGMPFTDPMAD 60 Query: 61 GPVIQKAGEKALSLGIGMVQVLDHVREFRKRNNTTPVVLMGYANPVERYDQKHGEGAFVR 120 GP IQ A +AL + + L VREFRK N+ TP+VLMGY NP+ RY G F+ Sbjct: 61 GPAIQLANIRALGAQQNLAKTLQMVREFRKDNSETPLVLMGYFNPIHRY----GVQRFIG 116 Query: 121 DSAAAGVDGVLIVDYPPEECEAFAASLRAHGMDLIFLLAPTSTDERMAEVARVASGYVYY 180 ++ +GVDG+++VD PPE +A G+D I L PT+ D R+ V +SG+VYY Sbjct: 117 EALESGVDGLIVVDMPPEHNSELCEPAQAAGLDFIRLTTPTTDDVRLPTVLNGSSGFVYY 176 Query: 181 VSLKGVTGSGALDTAAVEQMLPRIRQHVTIPVGVGFGIRDAATAQAIGKVADAVVIGSRI 240 VS+ GVTG+GA VE+ + R+R+H +P+ +GFGIR A AI ++AD VV+GS + Sbjct: 177 VSVAGVTGAGAATLEHVEEAVARLRRHTDLPISIGFGIRTPEQAAAIARLADGVVVGSAL 236 Query: 241 IQLIEDQEHAK-----VVPLTIDFLRGIRKA 266 I I + + A+ V+ L G+RKA Sbjct: 237 IDHIANADTAEQAIDGVLSLCAALADGVRKA 267 Lambda K H 0.321 0.137 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 238 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 269 Length of database: 270 Length adjustment: 25 Effective length of query: 244 Effective length of database: 245 Effective search space: 59780 Effective search space used: 59780 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
Align candidate Pf6N2E2_4047 (Tryptophan synthase alpha chain (EC 4.2.1.20))
to HMM TIGR00262 (trpA: tryptophan synthase, alpha subunit (EC 4.2.1.20))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00262.hmm # target sequence database: /tmp/gapView.1788.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00262 [M=256] Accession: TIGR00262 Description: trpA: tryptophan synthase, alpha subunit Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.5e-82 260.5 0.0 6.1e-82 260.3 0.0 1.0 1 lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_4047 Tryptophan synthase alpha chain Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_4047 Tryptophan synthase alpha chain (EC 4.2.1.20) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 260.3 0.0 6.1e-82 6.1e-82 1 254 [. 8 259 .. 8 261 .. 0.98 Alignments for each domain: == domain 1 score: 260.3 bits; conditional E-value: 6.1e-82 TIGR00262 1 fetlkkkeekafvpFvtagdPdleksleiiktlvkaGadalElGvpfsDPlaDGptiqaaelRA 64 f++lk+++ a+v+FvtagdPd+++sl i+k l aGad++ElG+pf DP+aDGp+iq a+ RA lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_4047 8 FAELKEQNRAALVTFVTAGDPDYDTSLAILKGLPAAGADVIELGMPFTDPMADGPAIQLANIRA 71 7899************************************************************ PP TIGR00262 65 lkagvkvekalellkkvrekasniPivlltyynlifkkgveeFyakakeagvdgvlvaDlPlee 128 l a +++k+l++++++r+++s+ P+vl+ y+n+i+++gv+ F+ +a e+gvdg++v+D+P e lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_4047 72 LGAQQNLAKTLQMVREFRKDNSETPLVLMGYFNPIHRYGVQRFIGEALESGVDGLIVVDMPPEH 135 **************************************************************** PP TIGR00262 129 addlleaakkhgvkqiflvaPtaeeerlkkiaekseGfvYlvsvaGvtgarerveeevkelikk 192 +++l e a+ g++ i l +Pt+++ rl ++ + s+GfvY vsvaGvtga e+v+e++++ lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_4047 136 NSELCEPAQAAGLDFIRLTTPTTDDVRLPTVLNGSSGFVYYVSVAGVTGAGAATLEHVEEAVAR 199 **************************************************************** PP TIGR00262 193 vkalskkPvlvGFGiskkeqvkelkelgadgvivGsAlvkiieeklddeekaleeleefvke 254 ++++++ P+ +GFGi +eq+ ++ l adgv+vGsAl++ i++ d+ e+a++ + +++ + lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_4047 200 LRRHTDLPISIGFGIRTPEQAAAIARL-ADGVVVGSALIDHIANA-DTAEQAIDGVLSLCAA 259 *************************99.9*************998.9999999887777665 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (256 nodes) Target sequences: 1 (270 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.00 # Mc/sec: 7.16 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory