Align Anthranilate synthase component 2; AS; ASII; Anthranilate synthase, GATase component; Anthranilate synthase, glutamine amidotransferase component; EC 4.1.3.27 (characterized)
to candidate Pf6N2E2_4510 Gamma-glutamyl-GABA hydrolase (EC 3.5.1.94)
Query= SwissProt::P26922 (196 letters) >FitnessBrowser__pseudo6_N2E2:Pf6N2E2_4510 Length = 258 Score = 51.6 bits (122), Expect = 1e-11 Identities = 48/157 (30%), Positives = 66/157 (42%), Gaps = 24/157 (15%) Query: 45 EGIVLSPGPC-DPDKAGICLPLIDAAAKAAVPLMGVCLGHQAIGQPFGGTV--------- 94 +G +PG DP + LPLI AA A +P++G+C G Q + FGG++ Sbjct: 77 QGPASAPGTAHDPARDATTLPLIRAAVDAGIPVLGICRGFQEMNVAFGGSLHQKVHEVGT 136 Query: 95 --------VRAPVPMHGKVDRMFHQGRGVLK--DLPSPFRATRYHSLIVERATLPACLEV 144 +A +G + Q GVL LP HS +ER L L Sbjct: 137 FIDHREDDTQAVDVQYGPAHAVHIQPGGVLAGLGLPQRIEVNSIHSQGIER--LAPGLRA 194 Query: 145 TGETEDGLIMALS--HRELPIHGVQFHPESIESEHGH 179 DGLI A+S + GVQ+HPE S + H Sbjct: 195 EAVAPDGLIEAVSVPGGKAFALGVQWHPEWEVSSNPH 231 Lambda K H 0.321 0.140 0.420 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 147 Number of extensions: 8 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 196 Length of database: 258 Length adjustment: 22 Effective length of query: 174 Effective length of database: 236 Effective search space: 41064 Effective search space used: 41064 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory