GapMind for Amino acid biosynthesis

 

Alignments for a candidate for trpE in Pseudomonas fluorescens FW300-N2E2

Align Anthranilate synthase component 1; AS; ASI; EC 4.1.3.27 (characterized)
to candidate Pf6N2E2_4822 Anthranilate synthase, aminase component (EC 4.1.3.27)

Query= SwissProt::P20579
         (493 letters)



>FitnessBrowser__pseudo6_N2E2:Pf6N2E2_4822
          Length = 493

 Score =  875 bits (2260), Expect = 0.0
 Identities = 436/491 (88%), Positives = 456/491 (92%)

Query: 1   MNREEFLRLAAVGYNRIPLACETLADFDTPLSIYLKLADQPNSYLLESVQGGEKWGRYSM 60
           MNREEFLRLAA GYNRIPLACETLADFDTPLSIYLKLADQPNSYLLESVQGGEKWGRYS+
Sbjct: 1   MNREEFLRLAAAGYNRIPLACETLADFDTPLSIYLKLADQPNSYLLESVQGGEKWGRYSI 60

Query: 61  IGLPSRTVMRVHGYHVSILHDGVEVESHDVEDPLAFVESFKDRYKVADIPGLPRFNGGLV 120
           IGLP RTV+RVH + VS+ HDGVE+ES +VEDPLAFVE+FK RY V  IPGLPRFNGGLV
Sbjct: 61  IGLPCRTVLRVHDHRVSVTHDGVEIESLEVEDPLAFVETFKARYNVPTIPGLPRFNGGLV 120

Query: 121 GYFGYDCVRYVEKRLGVSPNPDPLGVPDILLMVSDAVVVFDNLAGKMHAIVLVDPAEEQA 180
           GYFGYDCVRYVEKRLG  PNPDPLGVPDILLMVSDAVVVFDNLAGKMHAIVL DP++E A
Sbjct: 121 GYFGYDCVRYVEKRLGTCPNPDPLGVPDILLMVSDAVVVFDNLAGKMHAIVLADPSQEDA 180

Query: 181 FEQGQARLQGLLETLRQPITPRRGLDLSGPQAAEPEFRSSYTREDYENAVGRIKEYILAG 240
           +EQGQ  LQ LLE LRQPI PR GLD S   A +P FRSS+T++DYE AV  IKEYILAG
Sbjct: 181 YEQGQQSLQALLEKLRQPIAPRPGLDFSKQSATDPVFRSSFTQDDYERAVDTIKEYILAG 240

Query: 241 DCMQVVPSQRMSIDFKAAPIDLYRALRCFNPTPYMYFFNFGDFHVVGSSPEVLVRVEDNL 300
           DCMQVVPSQRMSIDFKAAPIDLYRALRCFNPTPYMYFFNFGDFHVVGSSPEVLVRVEDNL
Sbjct: 241 DCMQVVPSQRMSIDFKAAPIDLYRALRCFNPTPYMYFFNFGDFHVVGSSPEVLVRVEDNL 300

Query: 301 VTVRPIAGTRPRGATEEADRALEDDLLSDDKEIAEHLMLIDLGRNDVGRVSSTGSVRLTE 360
           +TVRPIAGTRPRGATEEADRALE+DLLSDDKEIAEHLMLIDLGRND GRVS  GSV+LTE
Sbjct: 301 ITVRPIAGTRPRGATEEADRALEEDLLSDDKEIAEHLMLIDLGRNDTGRVSEIGSVKLTE 360

Query: 361 KMVIERYSNVMHIVSNVAGQLREGLTAMDALRAILPAGTLSGAPKIRAMEIIDELEPVKR 420
           KMVIERYSNVMHIVSNV GQL+ GLTAMDALRAILPAGTLSGAPKIRAMEIIDELEPVKR
Sbjct: 361 KMVIERYSNVMHIVSNVTGQLKAGLTAMDALRAILPAGTLSGAPKIRAMEIIDELEPVKR 420

Query: 421 GVYGGAVGYFAWNGNMDTAIAIRTAVINDGELHVQAGGGIVADSVPALEWEETINKRRAM 480
           GVYGGAVGYFAWNGNMDTAIAIRTAVI +GELHVQAGGGIVADSVPALEWEET+NKRRAM
Sbjct: 421 GVYGGAVGYFAWNGNMDTAIAIRTAVIKNGELHVQAGGGIVADSVPALEWEETLNKRRAM 480

Query: 481 FRAVALAEQTS 491
           FRAVALAEQTS
Sbjct: 481 FRAVALAEQTS 491


Lambda     K      H
   0.320    0.138    0.403 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 905
Number of extensions: 22
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 493
Length of database: 493
Length adjustment: 34
Effective length of query: 459
Effective length of database: 459
Effective search space:   210681
Effective search space used:   210681
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 52 (24.6 bits)

Align candidate Pf6N2E2_4822 (Anthranilate synthase, aminase component (EC 4.1.3.27))
to HMM TIGR00564 (trpE: anthranilate synthase component I (EC 4.1.3.27))

Software error:

../bin/blast/fastacmd -i /tmp/list.609.in -d ../tmp/orgsFit/orgs.faa -p T > /tmp/gapView.609.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.

For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.