GapMind for Amino acid biosynthesis

 

Alignments for a candidate for tyrB in Pseudomonas fluorescens FW300-N2E2

Align Aromatic-amino-acid aminotransferase (EC 2.6.1.57) (characterized)
to candidate Pf6N2E2_50 Biosynthetic Aromatic amino acid aminotransferase alpha (EC 2.6.1.57) @ Aromatic-amino-acid aminotransferase (EC 2.6.1.57)

Query= reanno::Cup4G11:RR42_RS33490
         (400 letters)



>FitnessBrowser__pseudo6_N2E2:Pf6N2E2_50
          Length = 398

 Score =  414 bits (1065), Expect = e-120
 Identities = 206/396 (52%), Positives = 268/396 (67%)

Query: 1   MFEHIDAYPGDPILSLNESFQLDPRTDKVNLSIGIYFDDEGRLPVMQAVREAEAALMADM 60
           +F  ++  P DPIL LNE+F  D RT+KVNL +G+Y ++EGR+P+++AV EAE A +A  
Sbjct: 3   LFSAVELAPRDPILGLNEAFNADTRTNKVNLGVGVYCNEEGRIPLLRAVVEAETARVAQH 62

Query: 61  GPRPYLPMAGFAAYRDAVQALVFGQPCQARAEGRIATVQTLGGSGALRVGADFLKRYFPD 120
             R YLP+ G AAY  AVQ L+FG+       GR+ T Q +GG+GAL++GADFLK+  PD
Sbjct: 63  VSRGYLPIDGIAAYDQAVQTLLFGKDSPLITSGRVITTQAVGGTGALKIGADFLKQLLPD 122

Query: 121 AQVWISDPSWENHRVIFERTGFTVNTYPYYDDATGGLKFDAMLDALRLIPKRSIVLLHAC 180
           A V ISDPSWENHR +FE  GF V  Y YYD AT  +    +L+ L  +P RSIV+LHAC
Sbjct: 123 AVVAISDPSWENHRALFETAGFPVQNYRYYDAATHDVNRSGLLEDLNALPDRSIVVLHAC 182

Query: 181 CHNPTGVDLNHDQWRQLITLLKQHELLPFVDMAYQGFGAGLDDDAFAVRELVAQGVPCLV 240
           CHNPTGVDL+ + W+ ++ ++K    +PF+DMAYQGFGAG+D+DA AVR     G+    
Sbjct: 183 CHNPTGVDLSPEDWKNVLAVVKAKNHVPFLDMAYQGFGAGIDEDAAAVRLFAESGLTFFA 242

Query: 241 ANSFSKNFSLYGERCGGLSVVCDSAEETGRVLGQLTGAVRANYSNPPTHGARVVARVLTT 300
           ++SFSK+FSLYGER G LS+V +S EE+ RVL Q+   +R NYSNPPTHGA +VA VL +
Sbjct: 243 SSSFSKSFSLYGERVGALSIVSESKEESARVLSQVKRVIRTNYSNPPTHGASIVAAVLNS 302

Query: 301 PALRTIWERELAGKCERIAKMRAAIHKGLAAHVSGEALSRYLTQRGMFTYTGLTADQVDR 360
           P LR  WE ELA    RI  MR  +   LA        S    Q GMF+Y+GLT +QV R
Sbjct: 303 PELRAQWEAELAEMRLRIRGMRIQMVDMLAKAAPHHDFSFVARQSGMFSYSGLTVEQVTR 362

Query: 361 LRTEHGVYLLRSGRMCVAGLNERNVTQVAQAIASVL 396
           LR E G+Y L +GR+CVA LN+ N+  V +AI  V+
Sbjct: 363 LRNEFGIYALDTGRICVAALNQNNIDAVTKAIVQVI 398


Lambda     K      H
   0.323    0.137    0.417 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 442
Number of extensions: 18
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 400
Length of database: 398
Length adjustment: 31
Effective length of query: 369
Effective length of database: 367
Effective search space:   135423
Effective search space used:   135423
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 50 (23.9 bits)

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory