Align Putative asparagine synthetase [glutamine-hydrolyzing]; EC 6.3.5.4 (characterized)
to candidate 209647 DVUA0073 asparagine synthase (glutamine-hydrolyzing), putative
Query= SwissProt::P64248 (652 letters) >MicrobesOnline__882:209647 Length = 889 Score = 167 bits (423), Expect = 2e-45 Identities = 174/577 (30%), Positives = 249/577 (43%), Gaps = 78/577 (13%) Query: 35 HRGPDE---------------SGTWHAVDGASGG-----VVFGFNRLSIIDIAH-SHQPL 73 HRGPD +G H+ D + G V G RLSI+D++ S QPL Sbjct: 29 HRGPDAGYGVSFRRQSTGAFAAGRRHSADALAAGLEPAPVWLGHRRLSILDLSDKSAQPL 88 Query: 74 RWGPPEAPDRYVLVFNGEIYNYLELRDELRTQHGAVFATDGDGEAILAGYHHWGTEVLQR 133 R G +VFNGE++NY+ELR EL T G F T GD E +LA Y HWG L+R Sbjct: 89 RRGDLH------IVFNGELFNYIELRSEL-TALGEHFETSGDTEVLLASYRHWGAGCLER 141 Query: 134 LRGMFAFALWDTVTRELFCARDPFGIKPLFIATGAGGTAV-------ASEKKCL-LDLVE 185 G+FAFA++D LF ARDPFG+KP AV ASE K + + Sbjct: 142 FNGIFAFAIFDASRGSLFAARDPFGVKPFHYGVKPFHYAVTHDFLIFASEIKAISASGLV 201 Query: 186 LVGFDTEIDHRALQHYTVLQYVPEPETLHRGVRRLESGCFARIRADQLAPVITRYFVPRF 245 L +D ++ L + L P+ T +R++ G + + P +TRY+ PR Sbjct: 202 LRKWDPDVASAYLSY--ALTTAPQGRTFFENIRQIPPGHCLTLASPDDEPSVTRYYAPRI 259 Query: 246 AASPITNDNDQARYDEITAVLEDSVAKHMRADVTVGAFLSGGIDSTAIAALAIRHN--PR 303 +P + DE ++ S MR+D VG LS GIDS +AA + P Sbjct: 260 TETP---RSLHELVDEGAGLIRQSCRIRMRSDRDVGLCLSSGIDSANVAAALVAEGIAPE 316 Query: 304 LITFTTGFEREGFSEIDVAVASAEAIGARHIAKVVSADEFVAALPEIVWYL---DEPVAD 360 + E + A A+ +G H+ + D A +IV Y+ DEP Sbjct: 317 CYSIDAA-SSSMLDEFPLITALADKLGL-HVNPIRHPDAIPTA--DIVRYMLFNDEPSLF 372 Query: 361 PALVPLFFVAREARK-HVKVVLSGEGADELFGGYTIYREPLSLRPFDYLPKPLRRSMGKV 419 F + RE RK V V +SG G DELF GY Y P +R D L + RR M + Sbjct: 373 WGSYNQFHLYREMRKLGVIVSMSGHGGDELFCGYQRY-YPAVVR--DMLAQ--RRIMSLI 427 Query: 420 SKPLPEGMRGKSLLHRGSLTLEERYYGN--------ARSFSGAQLREVLPGFRPDWTHTD 471 L + + R ++ Y + A + L+ + +W T Sbjct: 428 WWCLRQSRH--LMQDRRTIRSTWDSYSHPLGWANDYAHDIAALHLKHTIAD-PEEWISTF 484 Query: 472 VTAPVYAESAGWDPVARMQHIDLFTWLRGDILVKADKITMANSLELRVPFLDPEVFAVAS 531 V A + E Q LFT+ +L AD+ +MA+ +E RVP LD ++ + Sbjct: 485 VGASSWGE---------QQQKSLFTYELQYLLRDADRNSMAHGIEERVPLLDTRLYEFCA 535 Query: 532 RLPAGAKITRTTTKYALRRALEPIVPAHV-LHRPKLG 567 +P + + L R L P +P + H+ K G Sbjct: 536 SVPL-KDLCQDGYLKGLARQLFPAIPESLRFHQIKRG 571 Lambda K H 0.323 0.138 0.428 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 1485 Number of extensions: 88 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 3 Number of HSP's successfully gapped: 2 Length of query: 652 Length of database: 889 Length adjustment: 40 Effective length of query: 612 Effective length of database: 849 Effective search space: 519588 Effective search space used: 519588 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 55 (25.8 bits)
Align candidate 209647 DVUA0073 (asparagine synthase (glutamine-hydrolyzing), putative)
to HMM TIGR01536 (asnB: asparagine synthase (glutamine-hydrolyzing) (EC 6.3.5.4))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01536.hmm # target sequence database: /tmp/gapView.7713.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01536 [M=517] Accession: TIGR01536 Description: asn_synth_AEB: asparagine synthase (glutamine-hydrolyzing) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.4e-108 347.9 0.0 4.9e-107 344.9 0.0 1.9 1 lcl|MicrobesOnline__882:209647 DVUA0073 asparagine synthase (gl Domain annotation for each sequence (and alignments): >> lcl|MicrobesOnline__882:209647 DVUA0073 asparagine synthase (glutamine-hydrolyzing), putative # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 344.9 0.0 4.9e-107 4.9e-107 1 509 [. 2 563 .. 2 571 .. 0.84 Alignments for each domain: == domain 1 score: 344.9 bits; conditional E-value: 4.9e-107 TIGR01536 1 CgiagivdlkakakeeeeaikemletlahRGPDaegvwkd........................ekeenailghrRLai 55 Cgiagi+ +k+ +++ ++ +++ml ++hRGPDa + + + lghrRL+i lcl|MicrobesOnline__882:209647 2 CGIAGIISRKDRNVS-SQPLNRMLTSQEHRGPDAGY--GVsfrrqstgafaagrrhsadalaagLEPAPVWLGHRRLSI 77 *********998666.59***************862..2235679****************98626789********** PP TIGR01536 56 idlseg.aQPlsnekevvivfnGEIYNheeLreeleekGyeFetksDtEViLaayeewgeelverLeGmFAfalwdekk 133 dls++ aQPl+ + ivfnGE++N+ eLr el + G +Fet DtEV+La+y++wg ++er++G FAfa++d+++ lcl|MicrobesOnline__882:209647 78 LDLSDKsAQPLRRGD-LHIVFNGELFNYIELRSELTALGEHFETSGDTEVLLASYRHWGAGCLERFNGIFAFAIFDASR 155 *****99*****999.68************************************************************* PP TIGR01536 134 gelflaRDrlGikPLY.......yaseqgkllfaSEiKallalkeikaeldkealaelltlq..lvptektlfkevkel 203 g lf+aRD++G+kP++ ya +++ l+faSEiKa+ a + ++ d ++++ +l++ + p+++t+f++++++ lcl|MicrobesOnline__882:209647 156 GSLFAARDPFGVKPFHygvkpfhYAVTHDFLIFASEIKAISASGLVLRKWDPDVASAYLSYAltTAPQGRTFFENIRQI 234 **********9877651111111667799***************9999999999999999887678999********** PP TIGR01536 204 epakal.....dgeekleeywevekeevkeseeelveelrelledavkkrlvadvpvgvllSGGlDSslvaaiakkeak 277 +p+++l d+e ++ +y+ + +e+ s++elv+e l++++ + r+++d+ vg++lS+G+DS vaa + +e lcl|MicrobesOnline__882:209647 235 PPGHCLtlaspDDEPSVTRYYAPRITETPRSLHELVDEGAGLIRQSCRIRMRSDRDVGLCLSSGIDSANVAAALVAEGI 313 ******9998877788888***************************************************987655533 PP TIGR01536 278 sevktFsigfedskdldeskaarkvadelgtehkevliseeevlkeleevilaleeptairasiplyllsklarekgvk 356 + + +si+ + s+ lde + ++ad+lg++ + + + +++ + +l +ep + s+ +++l +++r+ gv lcl|MicrobesOnline__882:209647 314 -APECYSIDAASSSMLDEFPLITALADKLGLHVNPIRHPDAIPTADIVRYMLFNDEPSLFWGSYNQFHLYREMRKLGVI 391 .359***************************99988877777788899999999************************* PP TIGR01536 357 VvLsGeGaDElfgGYeyfreakaeeale..........lpeaselaekkl.............llqaklakeselkell 412 V +sG G+DElf GY+++ a ++ l + + s+ + ++ + lcl|MicrobesOnline__882:209647 392 VSMSGHGGDELFCGYQRYYPAVVRDMLAqrrimsliwwCLRQSR-----HlmqdrrtirstwdS--------YSHPLGW 457 ******************99998888884555554333111122.....122222222332221........2222233 PP TIGR01536 413 kakleeelkekeelkkelkee.........seleellrldlelllsdllrak.DrvsmahslEvRvPflDkelvelals 481 ++ ++++ + +++ e s+ e +++ l ++ ++l+++ Dr smah++E RvP+lD +l e+++s lcl|MicrobesOnline__882:209647 458 ANDYAHDIAALHLKHTIADPEewistfvgaSSWGEQQQKSLFTYELQYLLRDaDRNSMAHGIEERVPLLDTRLYEFCAS 536 33444444444333333322245566666699999999999999999999999************************** PP TIGR01536 482 ippelklrdgkeKvlLreaaeellPeei 509 +p + ++dg K l r+++ + +Pe++ lcl|MicrobesOnline__882:209647 537 VPLKDLCQDGYLKGLARQLFPA-IPESL 563 ******************9964.56665 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (517 nodes) Target sequences: 1 (889 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.08u 0.01s 00:00:00.09 Elapsed: 00:00:00.08 # Mc/sec: 5.19 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory