GapMind for Amino acid biosynthesis

 

Alignments for a candidate for hisC in Desulfovibrio vulgaris Hildenborough

Align Histidinol-phosphate aminotransferase; EC 2.6.1.9; Imidazole acetol-phosphate transaminase (uncharacterized)
to candidate 206463 DVU1029 histidinol-phosphate aminotransferase

Query= curated2:Q311Z4
         (383 letters)



>MicrobesOnline__882:206463
          Length = 373

 Score =  504 bits (1299), Expect = e-147
 Identities = 250/363 (68%), Positives = 291/363 (80%), Gaps = 4/363 (1%)

Query: 19  IRPEVAAFKPYAPGLSIDEIKERYGLSQVVKMASNENPLGTSPLVQQTLRTHADLAFRYV 78
           +RPEV  FKPY PGLSIDEI++R+GL+ VVK+ASNENPLGTSP+VQ+TL+T ADLAFRY 
Sbjct: 12  VRPEVLDFKPYVPGLSIDEIRDRFGLADVVKLASNENPLGTSPVVQRTLKTKADLAFRYA 71

Query: 79  QSGNPRLVSAIARSFGVAAESVVTGNGSDEVIDLIIRVKARPGKHNIVAFNPCFSMYELQ 138
           QSGNPRL  AIA   GVA E VV GNGSDE+IDL+IRV+A PGKHNIVAF PCFS+YELQ
Sbjct: 72  QSGNPRLTRAIAAHHGVAPERVVAGNGSDEIIDLLIRVRATPGKHNIVAFRPCFSIYELQ 131

Query: 139 TRFCGVEFRQVPLRADFSFDYDAFVGAADADTAVAFITTPDNPSGYCPPVEEIIDLARRL 198
            +FCG+EFRQ  LR DF+FD+DAF+ A D +TA+AF+TTPDNPSG+CPPV E+  +AR L
Sbjct: 132 AKFCGLEFRQADLRPDFTFDWDAFLAATDENTAIAFVTTPDNPSGWCPPVSELEHVARTL 191

Query: 199 PSSCLLVVDEAYMDFADDPAAHSVLPHLTEFPNVAVLRTFSKSYGLAGLRLGFGVMHPAL 258
           P SCL V+DEAYMDF  D AAHS+L  L  FPN+AVLRTFSKS+GLAGLRLG+G++   L
Sbjct: 192 PPSCLFVIDEAYMDFCGDEAAHSLLSRLDAFPNIAVLRTFSKSFGLAGLRLGYGILPERL 251

Query: 259 ADYVKRVRLPFSINILAEYAGIAALQDTTFHAQTLRVTREGRTYLTGALTEAGCTVYPSA 318
           ADY+ RVRLPFS+NILAE AG+AAL+DT F ++TLRVT EGR Y+   LT  GC V PS 
Sbjct: 252 ADYLHRVRLPFSVNILAEEAGLAALEDTVFRSETLRVTAEGRAYIAEGLTALGCEVMPSW 311

Query: 319 ANFIMFALPENCPHDARAVFEALLRRGIIIRPLSSYNLPQCLRVSIGNRHENELFIAQFK 378
           ANFIMF      P DA  +FEALLRRGIIIRPL SY LPQ LRVS+GN  EN  FI   K
Sbjct: 312 ANFIMF----RPPTDATDLFEALLRRGIIIRPLKSYGLPQHLRVSVGNADENRRFIEACK 367

Query: 379 ELL 381
           E+L
Sbjct: 368 EIL 370


Lambda     K      H
   0.322    0.137    0.405 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 551
Number of extensions: 20
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 383
Length of database: 373
Length adjustment: 30
Effective length of query: 353
Effective length of database: 343
Effective search space:   121079
Effective search space used:   121079
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 50 (23.9 bits)

Align candidate 206463 DVU1029 (histidinol-phosphate aminotransferase)
to HMM TIGR01141 (hisC: histidinol-phosphate transaminase (EC 2.6.1.9))

Software error:

../bin/blast/fastacmd -i /tmp/list.5350.in -d ../tmp/orgsFit/orgs.faa -p T > /tmp/gapView.5350.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.

For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.