GapMind for Amino acid biosynthesis

 

Aligments for a candidate for prs in Desulfovibrio vulgaris Hildenborough

Align Ribose-phosphate pyrophosphokinase; RPPK; 5-phospho-D-ribosyl alpha-1-diphosphate; Phosphoribosyl diphosphate synthase; Phosphoribosyl pyrophosphate synthase; P-Rib-PP synthase; PRPP synthase; PRPPase; EC 2.7.6.1 (characterized)
to candidate 207025 DVU1575 ribose-phosphate pyrophosphokinase

Query= SwissProt::P0A1V6
         (315 letters)



>lcl|MicrobesOnline__882:207025 DVU1575 ribose-phosphate
           pyrophosphokinase
          Length = 312

 Score =  337 bits (864), Expect = 2e-97
 Identities = 167/311 (53%), Positives = 228/311 (73%), Gaps = 3/311 (0%)

Query: 3   DMKLFAGNATPELAQRIANRLYTSLGDAAVGRFSDGEVSVQINENVRGGDIFIIQSTCAP 62
           D+K+  G + PELA+ I N L   +  A    FSDGE+ ++I +NVRG D+F++Q+TCAP
Sbjct: 4   DLKILTGTSNPELAKAICNHLGCQITPALCETFSDGEIRIEIGDNVRGDDVFVVQATCAP 63

Query: 63  TNDNLMELVVMVDALRRASAGRITAVIPYFGYARQDRRVRSARVPITAKVVADFLSSVGV 122
            N NLM+L +M+DAL+RASAGR+TAV+PY+GYARQDR+V S R PI+AK+VADFL++ G 
Sbjct: 64  VNFNLMQLFLMLDALKRASAGRVTAVMPYYGYARQDRKV-SPRAPISAKLVADFLTTAGT 122

Query: 123 DRVLTVDLHAEQIQGFFDVPVDNVFGSPILLEDMLQLNLDNPIVVSPDIGGVVRARAIAK 182
           DRV+TVDLHA QIQGFF+ PVDN++ +P++L+ + Q+     ++VSPD GGV RARA AK
Sbjct: 123 DRVVTVDLHAGQIQGFFNSPVDNLYAAPVILDYLRQVE-GEIVIVSPDAGGVERARAYAK 181

Query: 183 LLNDTDMAIIDKRRPRANVSQVMHIIGDVAGRDCVLVDDMIDTGGTLCKAAEALKERGAK 242
            LN   +AI+DKRR + N +Q MH+IGDV  +  ++VDDMIDT GTLC A E L + GA+
Sbjct: 182 RLN-AGLAIVDKRRDKPNQAQAMHVIGDVRDKVAIVVDDMIDTAGTLCAAGEVLLKNGAR 240

Query: 243 RVFAYATHPIFSGNAANNLRNSVIDEVVVCDTIPLTDEIKALPNVRTLTLSGMLAEAIRR 302
            V A ATHP+ SG A   L NS   +V+V DT+PL D++ A P +  L+++G+LA+AI  
Sbjct: 241 EVMACATHPVLSGPAIERLCNSPFKQVIVTDTVPLGDKLNACPKLHVLSVAGLLAKAIHN 300

Query: 303 ISNEESISAMF 313
           I  E S+S +F
Sbjct: 301 IHTESSVSVLF 311


Lambda     K      H
   0.322    0.137    0.386 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 306
Number of extensions: 10
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 315
Length of database: 312
Length adjustment: 27
Effective length of query: 288
Effective length of database: 285
Effective search space:    82080
Effective search space used:    82080
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 48 (23.1 bits)

Align candidate 207025 DVU1575 (ribose-phosphate pyrophosphokinase)
to HMM TIGR01251 (prs: ribose-phosphate diphosphokinase (EC 2.7.6.1))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.aa/TIGR01251.hmm
# target sequence database:        /tmp/gapView.10705.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR01251  [M=309]
Accession:   TIGR01251
Description: ribP_PPkin: ribose-phosphate diphosphokinase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                       -----------
   1.5e-124  400.8   0.0   1.7e-124  400.7   0.0    1.0  1  lcl|MicrobesOnline__882:207025  DVU1575 ribose-phosphate pyropho


Domain annotation for each sequence (and alignments):
>> lcl|MicrobesOnline__882:207025  DVU1575 ribose-phosphate pyrophosphokinase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  400.7   0.0  1.7e-124  1.7e-124       2     308 ..       6     311 ..       5     312 .] 0.99

  Alignments for each domain:
  == domain 1  score: 400.7 bits;  conditional E-value: 1.7e-124
                       TIGR01251   2 kilsgssskelaekvaknlglelgdvevkkFadgElyvrieesvrgkdvfiivqstsapvndalmellllidalkrasa 80 
                                     kil g+s++ela++++++lg +++++  ++F+dgE+ ++i ++vrg dvf++ q t+apvn +lm+l l++dalkrasa
  lcl|MicrobesOnline__882:207025   6 KILTGTSNPELAKAICNHLGCQITPALCETFSDGEIRIEIGDNVRGDDVFVV-QATCAPVNFNLMQLFLMLDALKRASA 83 
                                     899*******************************************999999.************************** PP

                       TIGR01251  81 ksvtaviPyygYaRqdkkaksrepisaklvaklleeaGadrvltvdlHseqiqgfFdvpvenlsaspklieelkkkelk 159
                                     ++vtav+PyygYaRqd+k+++r pisaklva++l++aG+drv+tvdlH+ qiqgfF+ pv+nl+a+p+++++l++ +  
  lcl|MicrobesOnline__882:207025  84 GRVTAVMPYYGYARQDRKVSPRAPISAKLVADFLTTAGTDRVVTVDLHAGQIQGFFNSPVDNLYAAPVILDYLRQ-VEG 161
                                     **************************************************************************8.599 PP

                       TIGR01251 160 nlvvvsPDkGaverakkvakklglelaiieKeRdskenevevtnllgdvegkdvvivDDiisTggTlvkaaelLkekGA 238
                                     ++v+vsPD+G+vera+++ak+l++ lai++K+Rd k n+++ ++++gdv +k +++vDD+i+T+gTl++a e+L ++GA
  lcl|MicrobesOnline__882:207025 162 EIVIVSPDAGGVERARAYAKRLNAGLAIVDKRRD-KPNQAQAMHVIGDVRDKVAIVVDDMIDTAGTLCAAGEVLLKNGA 239
                                     **********************************.999***************************************** PP

                       TIGR01251 239 kkvivaathgvfsgdAlerlaeagveevivtntilv.ee.kklpkvseisvapliaeaiarihenesvsslf 308
                                     ++v+++ath+v+sg+A+erl ++ +++vivt+t++  ++ +++pk++++sva l+a+ai +ih+++svs lf
  lcl|MicrobesOnline__882:207025 240 REVMACATHPVLSGPAIERLCNSPFKQVIVTDTVPLgDKlNACPKLHVLSVAGLLAKAIHNIHTESSVSVLF 311
                                     ************************************9889******************************99 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (309 nodes)
Target sequences:                          1  (312 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01
# Mc/sec: 6.12
//
[ok]

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory