GapMind for Amino acid biosynthesis

 

Aligments for a candidate for leuA in Desulfovibrio vulgaris Hildenborough

Align 2-isopropylmalate synthase; EC 2.3.3.13; Alpha-IPM synthase; Alpha-isopropylmalate synthase (uncharacterized)
to candidate 207383 DVU1914 2-isopropylmalate synthase/homocitrate synthase family protein

Query= curated2:B8I1T7
         (508 letters)



>lcl|MicrobesOnline__882:207383 DVU1914 2-isopropylmalate
           synthase/homocitrate synthase family protein
          Length = 538

 Score =  188 bits (477), Expect = 5e-52
 Identities = 159/526 (30%), Positives = 254/526 (48%), Gaps = 36/526 (6%)

Query: 1   MARTIKIFDTTLRDGEQTPGVNLNLQEKLEIAKQLVRLGVDVIEGGFAIASPGDFESIMT 60
           M R I ++DTTLRDG Q+  +NLN  +KL+IA +L  LG+  IEGG+  ++P D      
Sbjct: 1   MRRQIHLYDTTLRDGSQSEDINLNTPDKLKIALRLDELGIAYIEGGWPGSNPVDVAFFKE 60

Query: 61  LSR-NLKGVTIASLCR----SVEKDIDRAWEAVQYAESPRIHTFIATSDIHMKYKLKMTE 115
           +   NLK   I++       S   + D   +A+  A +     F  + + H +  L++  
Sbjct: 61  IRNYNLKQAKISAFGSTHHPSHTAENDPNLKAIAAARTDAAAIFGKSCERHAREALRLDG 120

Query: 116 EEVLERAVSMVKRAKGYCSNVEFSAE---DASRTREEFLYRVVEAVIKAGATTVNIPDTV 172
              L+     +   K   + V F AE   D  R    +   V+    +AG   + + DT 
Sbjct: 121 RRNLDIIHDSIAFLKKQVAEVFFDAEHFFDGYRHNAAYALEVLRRAHEAGGDVLVLCDTN 180

Query: 173 GYSTPLEFGRLIRNIRNNVPNIDKADISVHCHNDLGLAVANSLAAVENGAVQVECTINGL 232
           G + P E   ++  +R  +P   +A + +H HND  +AVANS+AAV+ GAVQV+ T+NG+
Sbjct: 181 GGTLPHEVHDIVTAVREQLP---EAKLGIHAHNDCEVAVANSIAAVQAGAVQVQGTMNGV 237

Query: 233 GERAGNAALEEIIMGINTRK-DYYDITHRIDTTQIYRASRLVSSLTGVNVQPNKAIVGAN 291
           GER GNA L  +I  +  +    Y         Q+   S  VS +T +     +  VG +
Sbjct: 238 GERCGNANLSSVIPILELKSAGAYACLPEGRLQQLTAVSSYVSEVTNLPPFSRQPFVGRS 297

Query: 292 AFAHESGIHQHGVLSEKTTYEIMTPESVGMGTNRMVLGKLSGRHAFEDRLKEMGYSLSDE 351
           AFAH+ G+H   V    T YE +TPESVG    R+++ +L+GR       +  G+ L  +
Sbjct: 298 AFAHKGGVHVSAVNRNATLYEHITPESVG-NHQRVLITELAGRSNIVSLARRFGFHLDKD 356

Query: 352 E--VKTAFAKFKDLAD--KKKVVTDKDIEALVDENIA---VPEIFVIDSFQI---NSGNK 401
           E  VK    + K  A         +  +E L+   +A   V E F +  F++      N 
Sbjct: 357 EPVVKGLMNELKKKASLGYDYAAAEASVELLLLRKLARRGVREFFKLIQFRVLESKQEND 416

Query: 402 MISTSTVSVRKDEEIITE--AATGDGPVDAAFNAVERATGV------NAELVHYRIKAVT 453
           +   S  SV  + E I E  AATG GPV+A  NA+ +A            L+ ++++ +T
Sbjct: 417 LEPMSEASVMVEVEGIIEHTAATGRGPVNALDNALRKALSSFYPRIREMRLLDFKVRVLT 476

Query: 454 -----EGKDALGEVTVKISNNNSIFMGKGVSTDIIEASVKAYLNAI 494
                 G  +   V ++  + +S ++  GVS +IIEAS +A  +++
Sbjct: 477 GTETDGGTASTVRVLIESGDADSRWVTVGVSYNIIEASWQALADSM 522


Lambda     K      H
   0.315    0.131    0.357 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 530
Number of extensions: 23
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 508
Length of database: 538
Length adjustment: 35
Effective length of query: 473
Effective length of database: 503
Effective search space:   237919
Effective search space used:   237919
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory