GapMind for Amino acid biosynthesis

 

Alignments for a candidate for asd in Desulfovibrio vulgaris Hildenborough

Align Aspartate-semialdehyde dehydrogenase 2; ASA dehydrogenase 2; ASADH 2; Aspartate-beta-semialdehyde dehydrogenase 2; EC 1.2.1.11 (characterized)
to candidate 208563 DVU3048 aspartate-semialdehyde dehydrogenase

Query= SwissProt::P23247
         (337 letters)



>MicrobesOnline__882:208563
          Length = 349

 Score =  324 bits (830), Expect = 2e-93
 Identities = 171/330 (51%), Positives = 224/330 (67%), Gaps = 6/330 (1%)

Query: 7   VAIFGATGAVGETMLEVLQEREFPVDELFLLASERSEGKTYRFNGKTVRVQNVEEFDWSQ 66
           VA+ GATGAVG  ML+ L+ R+FP  E+   AS RS G    F    + V+ + E  ++ 
Sbjct: 8   VAVVGATGAVGREMLKTLEGRDFPAAEVIPFASARSAGSKVPFRDGELTVRELTEDCFTG 67

Query: 67  VHIALFSAGGELSAKWAPIAAEAGVVVIDNTSHFRYDYDIPLVVPEVNPEAIAEFRNRNI 126
           + IALFSAGG  S K+AP AA+AG VVIDN+S +R D   PLVVPEVNP  +    +  I
Sbjct: 68  IDIALFSAGGSTSEKFAPHAAKAGCVVIDNSSAWRMDARCPLVVPEVNPHHLEA--HNGI 125

Query: 127 IANPNCSTIQMLVALKPIYDAVGIERINVTTYQSVSGAGKAGIDELAGQTAKLLNGYPAE 186
           IANPNCSTIQM+VALKP++DA  I+R+ V+TYQ+VSG G+  IDEL  Q  ++ N    E
Sbjct: 126 IANPNCSTIQMVVALKPLHDAARIKRVIVSTYQAVSGTGQKAIDELDRQVRQMFNMMEPE 185

Query: 187 TNTFSQQIAFNCIPQIDQFMDNGYTKEEMKMVWETQKIFNDPSIMVNPTCVRVPVFYGHA 246
              +  +IAFNC+P ID F+DN YTKEEMKMV ET KI +DPS+ V  TCVRVPVFYGH+
Sbjct: 186 VQVYPHRIAFNCLPHIDVFLDNDYTKEEMKMVHETVKIMDDPSVKVTATCVRVPVFYGHS 245

Query: 247 EAVHVETRAPIDAEQVMDMLEQTDGIELFRGAD---FPTQVRDAGGKDHVLVGRVRNDIS 303
           E+V++ET   + A     +L Q  G++++       +P  + DA G+D   VGR+R D +
Sbjct: 246 ESVNIETEKKLTARDARAILSQAPGVQVYDNPGQKMYPMPI-DAAGEDATFVGRIREDET 304

Query: 304 HHSGINLWVVADNVRKGAATNAVQIAELLV 333
             +G+NLW+VADN+RKGAA NAVQIAE L+
Sbjct: 305 IENGLNLWIVADNIRKGAALNAVQIAEELI 334


Lambda     K      H
   0.319    0.135    0.395 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 352
Number of extensions: 11
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 337
Length of database: 349
Length adjustment: 29
Effective length of query: 308
Effective length of database: 320
Effective search space:    98560
Effective search space used:    98560
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 49 (23.5 bits)

Align candidate 208563 DVU3048 (aspartate-semialdehyde dehydrogenase)
to HMM TIGR01296 (asd: aspartate-semialdehyde dehydrogenase (EC 1.2.1.11))

Software error:

../bin/blast/fastacmd -i /tmp/list.18151.in -d ../tmp/orgsFit/orgs.faa -p T > /tmp/gapView.18151.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.

For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.