Align kynurenine-oxoglutarate transaminase (EC 2.6.1.7) (characterized)
to candidate 206268 DVU0841 aspartate aminotransferase, putative
Query= BRENDA::Q16773 (422 letters) >MicrobesOnline__882:206268 Length = 393 Score = 92.0 bits (227), Expect = 3e-23 Identities = 73/241 (30%), Positives = 118/241 (48%), Gaps = 23/241 (9%) Query: 27 EHDVVNLGQGFPDFPPPDFAVEAFQHAV--SGDFMLNQYTKTFGYPPLTKILASFFGELL 84 E V + G PD P P + + +G+ Y GY + LA+ Sbjct: 34 EDAVCDFSLGNPDLPAPAAVGDGLRAMADRAGEPFAFGYMPNGGYAWARQKLATHLSAEQ 93 Query: 85 GQEIDPLRNVLVTVGGYGALFTAFQALVDEGDEVIIIEPFFDCYEPMTMMAGGRPVFVSL 144 G + +V++T G G L F+A++DEGDEV+ + P+F Y GG VF ++ Sbjct: 94 GVSLTG-DDVVLTCGAAGGLNAFFRAVLDEGDEVLSMAPYFVEYGFYVENHGG--VFRTV 150 Query: 145 KPGPIQNGELGSSSNWQLDPMELAGKFTSRTKALVLNTPNNPLGKVFSREELELVASLCQ 204 K P G LD +ELA T RT+A+++N+PNNP G V+SR ELE +A + Sbjct: 151 KTLPDTFG-------LDLDAIELA--MTPRTRAVIINSPNNPTGAVYSRAELEGLADILA 201 Query: 205 Q------HDVVCITDEVYQWMVYDGHQHISIASLPGMWERTLTIGSAGKTFSATGWKVGW 258 + V I DE Y+++ +DG + + S+ +++ +L + S K S G ++G+ Sbjct: 202 RASARNGRPVFLIADEPYRFLAFDGAE---VPSVLPLYDHSLVVSSFSKNLSLAGERLGY 258 Query: 259 V 259 + Sbjct: 259 I 259 Lambda K H 0.323 0.139 0.435 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 374 Number of extensions: 18 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 422 Length of database: 393 Length adjustment: 31 Effective length of query: 391 Effective length of database: 362 Effective search space: 141542 Effective search space used: 141542 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory