Align LOR/SDH bifunctional enzyme conserved domain-containing protein (characterized, see rationale)
to candidate 208792 DVU3268 conserved hypothetical protein
Query= uniprot:Q6LXX7 (415 letters) >MicrobesOnline__882:208792 Length = 420 Score = 192 bits (489), Expect = 1e-53 Identities = 132/377 (35%), Positives = 191/377 (50%), Gaps = 56/377 (14%) Query: 85 PALKDSVLPDGFYSTTNHPTHVKVND-EWIEVANPKMDAVIVVYPEEKRAETKVIRKVKK 143 P D V P G+++T+ P ++ V W+ + +MD VI P+ E R++K Sbjct: 25 PGPADGVAPGGYHATSIFPEYLHVEQGRWVLLERSRMDCVIRQNPDGT-LEVVEFRRLKA 83 Query: 144 GDFVLIGHN-----GIRVMPPEKSREA-------------------GQLFEFM------- 172 GD V +G GI V P S A G+ + Sbjct: 84 GDLVALGRGEHAEEGILVHPAGFSASASDEETGPDATPRAPTSPPCGRCGDASVPASAVP 143 Query: 173 -NSEVSSEKPKEAIIKRIAKE---------MHEIREEYKKTGTGGIAIVGGPAIIHTGGG 222 S S+++ A I++E ++EI ++ G I V GPA++ Sbjct: 144 PGSPASTQEQPFAFRTGISRETSFSIDYDTLYEILRHDRENGF--IVWVAGPAVVFDADA 201 Query: 223 P-ALAKMVELGYIQAILAGNALATHDIESALYGTSLGVNIKTAKPVTGGHKHHIYAINAI 281 A A +VE GY+ A+LAGNALATHD+E ALYGT+LG I + GH HH+ INA+ Sbjct: 202 RNAFASLVEQGYVHALLAGNALATHDMEGALYGTALGQGIYHKRQAPMGHYHHLDCINAV 261 Query: 282 NDAGNIKNAVESGVLKEGIMYQCIKNNIPYVLAGSIRDDGPIPDVITDSMVAQDKMRTTV 341 +AG I AV SG++++G+M+ +K +P+VLAGSIRDDGP+PDVI D AQD MR V Sbjct: 262 REAGGIAAAVRSGLIRDGVMHAVVKYGVPFVLAGSIRDDGPLPDVIPDVYDAQDAMRQLV 321 Query: 342 MDKKMVIMLSTLLHSVATGNLMPSY----------IKTVCVDIQPSTVTKLMDRGTSQAI 391 V+ L+T LH++ATGN+ PSY + VD+ KL DRG+ A Sbjct: 322 SRATTVVALATQLHTIATGNMTPSYQVLEDGGVRPVHFFVVDMSEFAAGKLADRGSLSAR 381 Query: 392 GVVTDVGVFLVLLLKEL 408 ++T+V F+V + + L Sbjct: 382 AILTNVQDFVVNVTRAL 398 Lambda K H 0.317 0.136 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 367 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 415 Length of database: 420 Length adjustment: 32 Effective length of query: 383 Effective length of database: 388 Effective search space: 148604 Effective search space used: 148604 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory