Align Putative asparagine synthetase [glutamine-hydrolyzing] 2; EC 6.3.5.4 (uncharacterized)
to candidate WP_011382566.1 AMB_RS00600 asparagine synthase (glutamine-hydrolyzing)
Query= curated2:Q58456 (515 letters) >NCBI__GCF_000009985.1:WP_011382566.1 Length = 639 Score = 186 bits (473), Expect = 2e-51 Identities = 152/482 (31%), Positives = 229/482 (47%), Gaps = 54/482 (11%) Query: 1 MCGINGIIRFGKEVIKEEI-NKMNKAIKHRGPDDEGIFIYNFKNYSIGLGHVRLAILDLS 59 MCGI G++R G ++ + M A+ HRGPD GIF +GLG+ RLA++D + Sbjct: 1 MCGIFGMVRGGGRPVESNVLAAMKTALHHRGPDGNGIFAEG----PVGLGNTRLAVVDTA 56 Query: 60 EKGHQPMGYNVDEDKIIYRDDELDRADIIIVYNGEIYNYLELK---EKFNLETETGTDTE 116 G QP+ +D + IVYNGE++N+LEL+ E T +DTE Sbjct: 57 G-GSQPV---IDPS-----------SGAAIVYNGELFNHLELRAELESVGWCFRTHSDTE 101 Query: 117 VILKLYNKLGFDCVKEFNGMWAFCIFDKKKGLIFCSRDRLGVKPFYYYWDGNEFIFSSEL 176 V+L + G DCV FNGM+AF +FD K +F +RD G+KP Y + F+SE Sbjct: 102 VVLAAFCVWGEDCVLRFNGMYAFAVFDPKARRVFIARDPAGIKPLYLTETADGLAFASEA 161 Query: 177 KGILAVKEINKKENINKDAVELYFALGFIPSPYSIYKNTFKLEARQNLIFDLD----KRE 232 K +L + + A+ Y G++ S + K A DL+ + Sbjct: 162 KALLPI----AGRRPDWQALWGYLTYGYMAPDCSPFAGITKFPAGSLAWIDLELPAARLA 217 Query: 233 IRKYYYWELPDYKPIYDKKKLIEEGKKLLYDAVKIRMRSDVPVGAFLSGGLDSSTVV--G 290 +R Y+ P+ + + ++ LL AVK + SDVPVG FLSGGLDSS V Sbjct: 218 VRPYWQPRFGCGAPLAE-GEAVDRLDALLSQAVKHELMSDVPVGLFLSGGLDSSAVAYYA 276 Query: 291 VMREFTDLSKLHTFSIGF-EGKYDETPYIKIVVDYFKTQHHHYYFKERDFEELIDKYSWI 349 R +S +F + F E +DE+ + V + +H F E + + + Sbjct: 277 ARRHGQAIS---SFGLAFEETTHDESNDARTVARHLGIEHKELMFSPALVREGLRRVTET 333 Query: 350 YDEPFGDYSGFPTYKVSEMARKFVTVVLSGDGGDEVFGGYMTHLNGYRM-DFIRKLPKFL 408 DEPFGD + P +S AR+ VTVVL+G GGDEV GY T L +R+ R+LP L Sbjct: 334 MDEPFGDSTVVPLLMLSRFAREHVTVVLTGWGGDEVLAGYPT-LTAHRVASLYRRLPGML 392 Query: 409 RVVGSKLPVKKDLNGIANLYL-----LKEAFRLSLINPEE-------FYAESIKEDAIRP 456 +P D +++ YL + R + PE+ ++ ++ K + P Sbjct: 393 --AHGLVPALVDRLPVSDKYLSFEFKARRFLRGMKLTPEQQHFLWMGYFDDAFKHALLTP 450 Query: 457 EI 458 ++ Sbjct: 451 DV 452 Lambda K H 0.322 0.144 0.434 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 705 Number of extensions: 35 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 515 Length of database: 639 Length adjustment: 36 Effective length of query: 479 Effective length of database: 603 Effective search space: 288837 Effective search space used: 288837 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 53 (25.0 bits)
Align candidate WP_011382566.1 AMB_RS00600 (asparagine synthase (glutamine-hydrolyzing))
to HMM TIGR01536 (asnB: asparagine synthase (glutamine-hydrolyzing) (EC 6.3.5.4))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01536.hmm # target sequence database: /tmp/gapView.11534.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01536 [M=517] Accession: TIGR01536 Description: asn_synth_AEB: asparagine synthase (glutamine-hydrolyzing) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.6e-130 422.4 0.0 1.9e-130 422.2 0.0 1.0 1 lcl|NCBI__GCF_000009985.1:WP_011382566.1 AMB_RS00600 asparagine synthase Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000009985.1:WP_011382566.1 AMB_RS00600 asparagine synthase (glutamine-hydrolyzing) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 422.2 0.0 1.9e-130 1.9e-130 1 517 [] 2 560 .. 2 560 .. 0.90 Alignments for each domain: == domain 1 score: 422.2 bits; conditional E-value: 1.9e-130 TIGR01536 1 CgiagivdlkakakeeeeaikemletlahRGPDaegvwkdekeenailghrRLaiidlsegaQPlsnek 69 Cgi+g+v +e ++ +++m +l+hRGPD++g++ + ++lg RLa++d +g QP+ + + lcl|NCBI__GCF_000009985.1:WP_011382566.1 2 CGIFGMVRGGGRPVE-SNVLAAMKTALHHRGPDGNGIFAE---GPVGLGNTRLAVVDTAGGSQPVIDPS 66 *********887666.69*********************9...8**********************999 PP TIGR01536 70 .evvivfnGEIYNheeLreeleekGyeFetksDtEViLaayeewgeelverLeGmFAfalwdekkgelf 137 ++iv+nGE++Nh eLr+ele G F+t+sDtEV+Laa+ wge++v r++Gm+Afa++d k++++f lcl|NCBI__GCF_000009985.1:WP_011382566.1 67 sGAAIVYNGELFNHLELRAELESVGWCFRTHSDTEVVLAAFCVWGEDCVLRFNGMYAFAVFDPKARRVF 135 999****************************************************************** PP TIGR01536 138 laRDrlGikPLYyaseqgkllfaSEiKallalkeikaeldkealaelltlqlvptektlfkevkelepa 206 +aRD+ GikPLY +++++ l+faSE+Kall++ +++d +al+ +lt+ + +++ + f+++ +++++ lcl|NCBI__GCF_000009985.1:WP_011382566.1 136 IARDPAGIKPLYLTETADGLAFASEAKALLPIA--GRRPDWQALWGYLTYGYMAPDCSPFAGITKFPAG 202 ********************************9..69**************99**************** PP TIGR01536 207 kal.......dgeeklee..ywevekee.vkeseeelveelrelledavkkrlvadvpvgvllSGGlDS 265 + + + yw+ + e e+v++l+ ll +avk l++dvpvg++lSGGlDS lcl|NCBI__GCF_000009985.1:WP_011382566.1 203 SLAwidlelpAARLA--VrpYWQPRFGCgAPLAEGEAVDRLDALLSQAVKHELMSDVPVGLFLSGGLDS 269 *99998775444444..255*****99965567789********************************* PP TIGR01536 266 slvaaiakkeaksevktFsigfedskdldeskaarkvadelgtehkevliseeevlkeleevilaleep 334 s+va a++ + +++ +F ++fe + + des+ ar va++lg+ehke+++s++ v + l++v +++ep lcl|NCBI__GCF_000009985.1:WP_011382566.1 270 SAVAYYAARRHGQAISSFGLAFE-ETTHDESNDARTVARHLGIEHKELMFSPALVREGLRRVTETMDEP 337 ***********************.9******************************************** PP TIGR01536 335 tairasiplyllsklarekgvkVvLsGeGaDElfgGYeyfreakaeeale................... 384 + ++ ++pl++ls+ are+ v+VvL+G G+DE+++GY ++ + lcl|NCBI__GCF_000009985.1:WP_011382566.1 338 FGDSTVVPLLMLSRFAREH-VTVVLTGWGGDEVLAGYPTLTAHRVASLYRrlpgmlahglvpalvdrlp 405 *******************.******************999988888888999*******999999988 PP TIGR01536 385 ..............lpease.laekklllqaklakeselkellkakleeelkekeelkkelkee..... 433 + + ++ + e++++l +++ ++ ll +++++++++++l++ + lcl|NCBI__GCF_000009985.1:WP_011382566.1 406 vsdkylsfefkarrFLRGMKlTPEQQHFLWMGYFDDAFKHALLTPDVTAQVAQQDSLAHFAGMAagmae 474 888888877666664444445555565444444455555555555555555555444443333344555 PP TIGR01536 434 .seleellrldlelllsdllrak.DrvsmahslEvRvPflDkelvelalsippelklrdgkeKvlLrea 500 + ++++++ld+ ++l+++ +++ Dr++ma slE+RvP+l k+++++al +p+ lk+ g+ K lL++a lcl|NCBI__GCF_000009985.1:WP_011382566.1 475 pTLTDRIMHLDFRYFLHGNGLFQaDRMTMAASLEARVPLLNKQMLDFALPLPAGLKMAGGTPKGLLKKA 543 599***************999999********************************************* PP TIGR01536 501 aeellPeeileRkKeaf 517 ++ +lP +il +K++f lcl|NCBI__GCF_000009985.1:WP_011382566.1 544 LAPHLPPAILSKPKKGF 560 **************998 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (517 nodes) Target sequences: 1 (639 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.02 # Mc/sec: 11.05 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory