Align shikimate dehydrogenase (NADP+) (EC 1.1.1.25) (characterized)
to candidate WP_011382645.1 AMB_RS01000 molybdopterin-synthase adenylyltransferase MoeB
Query= BRENDA::A4QEK4 (276 letters) >NCBI__GCF_000009985.1:WP_011382645.1 Length = 266 Score = 40.0 bits (92), Expect = 5e-08 Identities = 43/136 (31%), Positives = 58/136 (42%), Gaps = 17/136 (12%) Query: 118 LGSASLAGKHAIVIGSGGTARPAIWALIEAGVARITVLNRSDRTAELQTLFDET------ 171 +G A L G A+VIG+GG P I L AGV I V++ D EL L + Sbjct: 23 IGQAKLLGSSALVIGAGGLGSPVILYLAAAGVGTIGVIDDDD--VELSNLQRQIIHRTSN 80 Query: 172 --PTTLAYAPLEHLDIEADVVVSTVPSAAIAGLEDTLAIAPVLDVI---YDPWPTPLV-- 224 +A A DI DV V VP A G ++ I VI D +PT + Sbjct: 81 VGAAKVASAAAAVADINPDVKV--VPIRARLGKDNARDIFRDFQVIADGSDNFPTRFLVN 138 Query: 225 EVARAKGLKAVGGHVM 240 + AR +G V ++ Sbjct: 139 DAARLEGKTLVSAAIL 154 Lambda K H 0.316 0.133 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 156 Number of extensions: 7 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 276 Length of database: 266 Length adjustment: 25 Effective length of query: 251 Effective length of database: 241 Effective search space: 60491 Effective search space used: 60491 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory