GapMind for Amino acid biosynthesis

 

Alignments for a candidate for asp-kinase in Magnetospirillum magneticum AMB-1

Align Aspartate kinase; Aspartokinase; EC 2.7.2.4 (characterized)
to candidate WP_011384021.1 AMB_RS08140 aspartate kinase

Query= SwissProt::C3JXY0
         (413 letters)



>NCBI__GCF_000009985.1:WP_011384021.1
          Length = 406

 Score =  437 bits (1125), Expect = e-127
 Identities = 233/410 (56%), Positives = 307/410 (74%), Gaps = 8/410 (1%)

Query: 1   MALIVQKFGGTSVGSVERIEQVADKVKKFRDAGDDLVVVLSAMSGETNRLIDLAKAISGD 60
           MA IV KFGGTSV  +ERI+ VA++VK+  DAG+ + VV+SAMSG TN+L+     ++  
Sbjct: 1   MARIVMKFGGTSVADIERIKNVANRVKREFDAGNQVAVVVSAMSGATNQLVAWCNQVA-- 58

Query: 61  QQPL--PRELDVIVSTGEQVTIALLAMALNKRGVPAVSYTGSQVRILTDSAHTKARILQI 118
             PL   RE D +V+TGEQVT  LLA+AL + GV A S+ G Q+ I TD  H KARI+ I
Sbjct: 59  --PLHDAREYDAVVATGEQVTTGLLAIALQELGVNARSWCGWQLPIRTDGVHGKARIMSI 116

Query: 119 DDQKIRTDLKAGRVVVVAGFQGVDEQGNITTLGRGGSDTTGVALAAALKADECQIYTDVD 178
           +  ++   +  G V VVAGFQG+     I TLGRGGSDT+ VALAAAL AD C IYTDVD
Sbjct: 117 ETDEMIARMGKGEVAVVAGFQGLGPDNRIATLGRGGSDTSAVALAAALHADRCDIYTDVD 176

Query: 179 GVYTTDPRVVSVAQRLDKITFEEMLEMASLGSKVLQIRAVEFAGKYNVPLRVLHSFKEGP 238
           GVYTTDPR+VSVA++LDKIT+EEMLE+AS+G+KVLQ R+VE A K+ V ++VL SF++ P
Sbjct: 177 GVYTTDPRIVSVAKKLDKITYEEMLELASVGAKVLQTRSVEMAMKHRVRVQVLSSFEDKP 236

Query: 239 GTLITIDEEESMEQPIISGIAFNRDEAKLTIRGVPDTPGVAFKILGPISGANIEVDMIVQ 298
           GTL+  DE+E +E+ ++SGIA++RDEAK+T+  V D PGVA  I GP++ A + VDMIVQ
Sbjct: 237 GTLV-CDEDEIVEKELVSGIAYSRDEAKITLVRVADRPGVAASIFGPLAEAAVNVDMIVQ 295

Query: 299 NVSHD-NTTDFTFTVHRNEYDAAERILQNTAKEIGAREVVGDTKIAKVSIVGVGMRSHAG 357
           NVS D  +TD TFTV   + + A+++L++    +G  +++ D  + KVS++GVGMRSHAG
Sbjct: 296 NVSEDGKSTDLTFTVGNADLERAKKVLEDAKGNLGFEKLLADPNVVKVSVIGVGMRSHAG 355

Query: 358 VASRMFEALAKESINIQMISTSEIKVSVVIEEKYLELAVRALHTAFELDA 407
           +A +MF+ LA E INIQ+ISTSEIK+SV+IEEKY ELA+RALHTA+ LDA
Sbjct: 356 IAQKMFQTLASEGINIQVISTSEIKISVLIEEKYTELALRALHTAYGLDA 405


Lambda     K      H
   0.316    0.133    0.357 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 452
Number of extensions: 14
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 413
Length of database: 406
Length adjustment: 31
Effective length of query: 382
Effective length of database: 375
Effective search space:   143250
Effective search space used:   143250
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 50 (23.9 bits)

Align candidate WP_011384021.1 AMB_RS08140 (aspartate kinase)
to HMM TIGR00656 (aspartate kinase, monofunctional class (EC 2.7.2.4))

Software error:

../bin/blast/fastacmd -i /tmp/list.10399.in -d ../tmp/orgsFit/orgs.faa -p T > /tmp/gapView.10399.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.

For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.