GapMind for Amino acid biosynthesis

 

Alignments for a candidate for cysE in Magnetospirillum magneticum AMB-1

Align Serine acetyltransferase; SAT; EC 2.3.1.30 (uncharacterized)
to candidate WP_011382553.1 AMB_RS00535 N-acetyltransferase

Query= curated2:Q65PC9
         (216 letters)



>NCBI__GCF_000009985.1:WP_011382553.1
          Length = 159

 Score = 46.2 bits (108), Expect = 3e-10
 Identities = 36/130 (27%), Positives = 55/130 (42%), Gaps = 28/130 (21%)

Query: 66  GIEIHPGAKIGRRFFIDHGMGVVIGETCEIGNNVTVFQGVTLG----------------- 108
           G  I    KIG   F++   G  IG  C+I ++  V +GVT+                  
Sbjct: 25  GCSIGDETKIGA--FVEIQGGATIGARCKISSHSFVCEGVTIEDEVFVGHGVMFTNDVYP 82

Query: 109 ---------GTGKEKGKRHPTIEDDALISTGAKVLGSITVGRGAKIGAGSVVLHDVPECS 159
                     T  +       ++  A I +GA +L ++T+G  A + AG+VV  DVP  +
Sbjct: 83  RATTPDGALATAADWTCSPTVVKRRASIGSGATILPNLTIGENALVAAGAVVTKDVPANA 142

Query: 160 TVVGIPGRVV 169
            V G+P  VV
Sbjct: 143 IVAGVPAVVV 152


Lambda     K      H
   0.323    0.142    0.416 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 110
Number of extensions: 8
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 2
Number of HSP's successfully gapped: 1
Length of query: 216
Length of database: 159
Length adjustment: 19
Effective length of query: 197
Effective length of database: 140
Effective search space:    27580
Effective search space used:    27580
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 44 (21.6 bits)

This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory