Align serine O-acetyltransferase (EC 2.3.1.30) (characterized)
to candidate WP_083763388.1 AMB_RS00270 hypothetical protein
Query= BRENDA::P95231 (229 letters) >NCBI__GCF_000009985.1:WP_083763388.1 Length = 243 Score = 57.4 bits (137), Expect = 2e-13 Identities = 44/142 (30%), Positives = 65/142 (45%), Gaps = 12/142 (8%) Query: 37 GHRLAHWLWQRGARLLARAAAEFTRILTGVDIHPGAVIG--------ARVFIDHATG--V 86 G+ H +L A + F+ I + G V+G A V +D G Sbjct: 93 GNPYGHVRRHLAQKLAALGLSPFSLIDPTAMVSAGVVLGTGLQMMPFALVHVDAVVGDQC 152 Query: 87 VIGETAEVGDDVTIYHGVTLGGSGMVGGKRHPTVGDRVIIGAGAKVLGPIKIGEDSRIGA 146 ++ A V D + GV +G + G+ H VG IGAGA VL + IG +S +GA Sbjct: 153 IVNTRATVEHDCVLADGVEIGPGATLCGRVH--VGRDTWIGAGATVLPRLAIGANSIVGA 210 Query: 147 NAVVVKPVPPSAVVVGVPGQVI 168 AVV + +P + VV G P +V+ Sbjct: 211 GAVVTRDIPDNVVVAGNPAKVL 232 Score = 38.1 bits (87), Expect = 2e-07 Identities = 36/136 (26%), Positives = 60/136 (44%), Gaps = 10/136 (7%) Query: 63 LTGVDIHPGAVIGARVFIDHATGVVIGETAEVGDDVTIYHGVTLGGSGMVGGK---RHPT 119 L + + P ++I + + GVV+G ++ ++ +G +V + H Sbjct: 107 LAALGLSPFSLIDPTAMV--SAGVVLGTGLQMMPFALVHVDAVVGDQCIVNTRATVEHDC 164 Query: 120 V-GDRVIIGAGAKVLGPIKIGEDSRIGANAVVVKPVPPSAVVVGVPGQVIGQSQPS---- 174 V D V IG GA + G + +G D+ IGA A V+ + A + G V+ + P Sbjct: 165 VLADGVEIGPGATLCGRVHVGRDTWIGAGATVLPRLAIGANSIVGAGAVVTRDIPDNVVV 224 Query: 175 PGGPFDWRLPDLVGAS 190 G P P+LV AS Sbjct: 225 AGNPAKVLRPNLVRAS 240 Lambda K H 0.321 0.141 0.443 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 162 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 229 Length of database: 243 Length adjustment: 23 Effective length of query: 206 Effective length of database: 220 Effective search space: 45320 Effective search space used: 45320 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory