Align cysteine synthase (EC 2.5.1.47) (characterized)
to candidate WP_011382646.1 AMB_RS01005 cysteine synthase A
Query= BRENDA::Q2PZM5 (319 letters) >NCBI__GCF_000009985.1:WP_011382646.1 Length = 319 Score = 476 bits (1225), Expect = e-139 Identities = 234/311 (75%), Positives = 276/311 (88%), Gaps = 1/311 (0%) Query: 6 FRGKIYDSILDTVGATPLVRVNRLAEDAGAKAQIVGKLEFFNPLASVKDRIGFAMIDAAE 65 FRGKIYDSI+DT+GATPLVR R+A +AG+KA IVGKLEFFNPLASVKDRIGFAMI+AAE Sbjct: 8 FRGKIYDSIIDTIGATPLVRFKRMAAEAGSKADIVGKLEFFNPLASVKDRIGFAMIEAAE 67 Query: 66 RAGTIEPGRTTLVEPTSGNTGIALAFVAAAKGYRLILTMPESMSVERRKMLKLLGAELVL 125 +G ++PG T ++EPTSGNTGIALAFVAAAKGY+LIL MPESMS+ERRKML+LLGAE+VL Sbjct: 68 VSGQLKPGGT-IIEPTSGNTGIALAFVAAAKGYKLILCMPESMSLERRKMLQLLGAEIVL 126 Query: 126 TPAAEGMKGAIRRADEIVATDPNAYMLQQFKNAANPEIHRNTTAEEIWKDTDGKADFLIS 185 TPA++GM GA+R+A+E++A+ P A M QQFKN ANP IH TTAEEIW DT+GK D ++S Sbjct: 127 TPASKGMTGAVRQAEELLASTPGAIMPQQFKNEANPAIHERTTAEEIWNDTNGKVDIIVS 186 Query: 186 GVGTGGTLTGVSEVLKARKPGFRTIAVEPEDSPVLSGGMPGPHKIQGIGAGFVPDVLKKD 245 GVGTGGT++G+ VLKARKPG + +AVEPEDSPVLSGG PGPHKIQGIGAGFVPD+L K Sbjct: 187 GVGTGGTISGIGHVLKARKPGLKMVAVEPEDSPVLSGGAPGPHKIQGIGAGFVPDILDKG 246 Query: 246 LIDEVVRISNQRAFETARKVAKLEGIPVGISSGAALAAALEIGSRPENEGKLIVVILPSF 305 +IDE+++I N+ A TARK AKLEG+PVGISSGAA+AAALE+GSRPEN GKLIV I+PSF Sbjct: 247 VIDEILQIGNETALATARKAAKLEGVPVGISSGAAIAAALELGSRPENAGKLIVAIIPSF 306 Query: 306 AERYLSTALFE 316 AERYLSTALF+ Sbjct: 307 AERYLSTALFD 317 Lambda K H 0.316 0.135 0.376 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 413 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 319 Length of database: 319 Length adjustment: 28 Effective length of query: 291 Effective length of database: 291 Effective search space: 84681 Effective search space used: 84681 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
Align candidate WP_011382646.1 AMB_RS01005 (cysteine synthase A)
to HMM TIGR01139 (cysK: cysteine synthase A (EC 2.5.1.47))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01139.hmm # target sequence database: /tmp/gapView.27059.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01139 [M=298] Accession: TIGR01139 Description: cysK: cysteine synthase A Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.8e-136 439.2 1.7 4.3e-136 439.0 1.7 1.0 1 lcl|NCBI__GCF_000009985.1:WP_011382646.1 AMB_RS01005 cysteine synthase A Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000009985.1:WP_011382646.1 AMB_RS01005 cysteine synthase A # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 439.0 1.7 4.3e-136 4.3e-136 3 298 .] 18 316 .. 16 316 .. 0.98 Alignments for each domain: == domain 1 score: 439.0 bits; conditional E-value: 4.3e-136 TIGR01139 3 eliGntPlvrLn...laeeakaevlvkleslnPsssvkdrialamiedaekegllkkgktiveatsGnt 68 ++iG tPlvr + +++ ka+++ kle++nP +svkdri++amie ae +g+lk+g ti+e+tsGnt lcl|NCBI__GCF_000009985.1:WP_011382646.1 18 DTIGATPLVRFKrmaAEAGSKADIVGKLEFFNPLASVKDRIGFAMIEAAEVSGQLKPGGTIIEPTSGNT 86 79*********97544567899*********************************************** PP TIGR01139 69 GialamvaaargykliltmpetmslerrkllkayGaelvLtdgaegmkgaiekaeelveetpnkylllk 137 Giala+vaaa+gyklil+mpe+mslerrk+l+ +Gae+vLt++++gm+ga+++aeel+++tp ++++ lcl|NCBI__GCF_000009985.1:WP_011382646.1 87 GIALAFVAAAKGYKLILCMPESMSLERRKMLQLLGAEIVLTPASKGMTGAVRQAEELLASTPG-AIMPQ 154 **************************************************************5.55*** PP TIGR01139 138 qfenpanpeihrkttapeilkdldgkldafvagvGtGGtitGvgevlkekkpdikvvavePaespvlsg 206 qf+n+anp+ih++tta+ei++d++gk+d++v+gvGtGGti+G+g+vlk kp +k+vaveP++spvlsg lcl|NCBI__GCF_000009985.1:WP_011382646.1 155 QFKNEANPAIHERTTAEEIWNDTNGKVDIIVSGVGTGGTISGIGHVLKARKPGLKMVAVEPEDSPVLSG 223 ********************************************************************* PP TIGR01139 207 gkpgphkiqGigagfiPkvLdkevidevikvsdeeaietarrlakeeGilvGissGaavaaalkvakkl 275 g pgphkiqGigagf+P++Ldk vide++++ +e+a++tar+ ak eG+ vGissGaa+aaal++ ++ lcl|NCBI__GCF_000009985.1:WP_011382646.1 224 GAPGPHKIQGIGAGFVPDILDKGVIDEILQIGNETALATARKAAKLEGVPVGISSGAAIAAALELGSRP 292 ********************************************************************9 PP TIGR01139 276 e.kdkkivvilpdtgerYlstaLf 298 e ++k+iv+i+p+++erYlstaLf lcl|NCBI__GCF_000009985.1:WP_011382646.1 293 EnAGKLIVAIIPSFAERYLSTALF 316 99*********************9 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (298 nodes) Target sequences: 1 (319 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.01 # Mc/sec: 8.44 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory