Align phosphoserine aminotransferase monomer (EC 2.6.1.52; EC 2.6.1.1) (characterized)
to candidate WP_011385559.1 AMB_RS16135 phosphoserine transaminase
Query= metacyc::MONOMER-15918 (370 letters) >NCBI__GCF_000009985.1:WP_011385559.1 Length = 392 Score = 497 bits (1279), Expect = e-145 Identities = 235/379 (62%), Positives = 291/379 (76%), Gaps = 10/379 (2%) Query: 2 KPTRVPKNPCFSSGPCAKHPGYSVEELKDTPFGRSHRSKPGKEKLAEAIKRTRDMLGLPD 61 KP P NP FSSGPCAK PG++V+ LKDTP GRSHR+K GK KL E I RTR +LG+P Sbjct: 6 KPAAKPANPNFSSGPCAKRPGWTVDALKDTPVGRSHRAKIGKTKLEELINRTRSVLGIPA 65 Query: 62 DYFVGIVPASDTGAFEMCLWSMLGCRGVDVLVWESFSKGWATDITKQLKLKDTRVFEAEY 121 DY +GIVPASDTGA EM +WS+LG RG+D L WESF +GW TDITKQLK++DTRVF+A Y Sbjct: 66 DYRIGIVPASDTGAVEMAMWSLLGARGIDALAWESFGEGWVTDITKQLKIEDTRVFKAPY 125 Query: 122 GKLPDLKKVDFKNDVVFVWNGTTSGVKVPNADWIPDDREGVTLCDATSAIFAMDIPYHKL 181 G LP+L +VD DVVF WNGTT GV++PN DWI DR+G+T+CDATSA+FAMD+P+ KL Sbjct: 126 GTLPNLAEVDCDRDVVFTWNGTTGGVRIPNGDWIKSDRKGLTICDATSAVFAMDMPWDKL 185 Query: 182 DVITFSWQKVLGGEGAHGMLILSPRAVQRLESYTPAWPLPKIFRLTKGGKLNKDIFAGST 241 DV+T+SWQKVLGGEGAHGML+LSPRAV+RLE+Y P+WPLPKIFR+TKGGKL + IF G T Sbjct: 186 DVVTWSWQKVLGGEGAHGMLVLSPRAVERLETYKPSWPLPKIFRMTKGGKLIEGIFKGET 245 Query: 242 INTPSMLANEDWLATLKWAESVGGLKQLIRRTNENLAVFEAFVAKNNWIHFLAETKEIRS 301 INTPSM+A ED + LKWAES+GGLK LI R+ NL ++++ K+ W LA+ ++RS Sbjct: 246 INTPSMIAVEDQIDALKWAESIGGLKALIARSEANLKAVQSWLDKSAWAANLADDAKVRS 305 Query: 302 STSVCFKV----------DLSDEKLKELIKTLEKEKVAYDIGSYRDAPSGLRIWCGATVE 351 TS+C V D K+++ L+KE VAYDIG+YRDAP+GLR+W GATVE Sbjct: 306 CTSICMIVKAPFFAKLSPDDQAAAAKKIVTLLDKEGVAYDIGAYRDAPAGLRVWGGATVE 365 Query: 352 KEDLECLCEWIEWAYNLVK 370 D+E L W++WA+ VK Sbjct: 366 TSDVEKLLPWLDWAFAQVK 384 Lambda K H 0.319 0.136 0.430 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 545 Number of extensions: 22 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 370 Length of database: 392 Length adjustment: 30 Effective length of query: 340 Effective length of database: 362 Effective search space: 123080 Effective search space used: 123080 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate WP_011385559.1 AMB_RS16135 (phosphoserine transaminase)
to HMM TIGR01365 (phosphoserine aminotransferase (EC 2.6.1.52))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01365.hmm # target sequence database: /tmp/gapView.32191.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01365 [M=374] Accession: TIGR01365 Description: serC_2: phosphoserine aminotransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.4e-203 659.8 3.6 7.4e-203 659.6 3.6 1.0 1 lcl|NCBI__GCF_000009985.1:WP_011385559.1 AMB_RS16135 phosphoserine transa Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000009985.1:WP_011385559.1 AMB_RS16135 phosphoserine transaminase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 659.6 3.6 7.4e-203 7.4e-203 1 373 [. 10 382 .. 10 383 .. 0.99 Alignments for each domain: == domain 1 score: 659.6 bits; conditional E-value: 7.4e-203 TIGR01365 1 rpanpefssgpcakrpgysveelknaalgrshrsklgkeklkeaiektrevlevpadyligivaasdtg 69 +panp+fssgpcakrpg++v++lk++++grshr+k+gk+kl+e i++tr vl++pady+igiv+asdtg lcl|NCBI__GCF_000009985.1:WP_011385559.1 10 KPANPNFSSGPCAKRPGWTVDALKDTPVGRSHRAKIGKTKLEELINRTRSVLGIPADYRIGIVPASDTG 78 69******************************************************************* PP TIGR01365 70 avemalwsllgargvdllafesfgkgwvtdvtkqlklkdvrvleaeygklpdlkkvdfkkdvvftwngt 138 avema+wsllgarg+d la+esfg+gwvtd+tkqlk++d rv++a+yg lp+l+ vd ++dvvftwngt lcl|NCBI__GCF_000009985.1:WP_011385559.1 79 AVEMAMWSLLGARGIDALAWESFGEGWVTDITKQLKIEDTRVFKAPYGTLPNLAEVDCDRDVVFTWNGT 147 ********************************************************************* PP TIGR01365 139 tsgvrvpngdfipadreglticdatsaafaqdldyekldvvtfswqkvlggegahgvlilspravarle 207 t gvr+pngd+i +dr+glticdatsa+fa+d++++kldvvt+swqkvlggegahg+l+lsprav+rle lcl|NCBI__GCF_000009985.1:WP_011385559.1 148 TGGVRIPNGDWIKSDRKGLTICDATSAVFAMDMPWDKLDVVTWSWQKVLGGEGAHGMLVLSPRAVERLE 216 ********************************************************************* PP TIGR01365 208 sytpawplpkifrltkggklskdifegetintpsmlavedaldalkwaesigglkalvaraddnlavle 276 +y+p+wplpkifr+tkggkl+++if+getintpsm+aved +dalkwaesigglkal+ar+++nl+ ++ lcl|NCBI__GCF_000009985.1:WP_011385559.1 217 TYKPSWPLPKIFRMTKGGKLIEGIFKGETINTPSMIAVEDQIDALKWAESIGGLKALIARSEANLKAVQ 285 ********************************************************************* PP TIGR01365 277 afvaksswvdflaatkeirsntsvclkvvdpdvaaldedaqadfakelvsalekegvaydigsyrdapa 345 ++++ks+w la ++rs ts+c+ v p a l d qa ak++v++l+kegvaydig+yrdapa lcl|NCBI__GCF_000009985.1:WP_011385559.1 286 SWLDKSAWAANLADDAKVRSCTSICMIVKAPFFAKLSPDDQAAAAKKIVTLLDKEGVAYDIGAYRDAPA 354 ***********************************99999***************************** PP TIGR01365 346 glriwcgatveksdleallewldwafal 373 glr+w gatve+sd+e ll+wldwafa lcl|NCBI__GCF_000009985.1:WP_011385559.1 355 GLRVWGGATVETSDVEKLLPWLDWAFAQ 382 **************************97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (374 nodes) Target sequences: 1 (392 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 9.17 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory