GapMind for Amino acid biosynthesis

 

Alignments for a candidate for hisH in Magnetospirillum magneticum AMB-1

Align Imidazole glycerol phosphate synthase subunit HisH; IGP synthase glutaminase subunit; IGP synthase subunit HisH; ImGP synthase subunit HisH; IGPS subunit HisH; EC 4.3.2.10; EC 3.5.1.2 (characterized)
to candidate WP_083763585.1 AMB_RS22935 imidazole glycerol phosphate synthase subunit HisH

Query= SwissProt::P59957
         (206 letters)



>NCBI__GCF_000009985.1:WP_083763585.1
          Length = 216

 Score =  136 bits (343), Expect = 2e-37
 Identities = 90/211 (42%), Positives = 114/211 (54%), Gaps = 16/211 (7%)

Query: 6   VVVLDYGSGNLRSAQRALQRVGAE------VEVTADTDAAMTADGLVVPGVGAFAACMAG 59
           V ++DYGSGNLRSA +A +RV AE      V VT D      AD +V+PGVGAFA C AG
Sbjct: 5   VAIIDYGSGNLRSAAKAFERVVAEASLNLSVAVTNDPKVVDRADRVVLPGVGAFADCRAG 64

Query: 60  LRKISG-ERIIAERV-AAGRPVLGVCVGMQILFACGVEFGVQTPGCGHWPGAVIRL---- 113
           L  + G    + ERV A G P  G+CVGMQ++ + G E G+   G G   G V+ L    
Sbjct: 65  LLALPGMAETLTERVLARGVPFFGICVGMQLMASIGREHGLHA-GLGWVAGEVVPLGVED 123

Query: 114 EAPVIPHMGWN-VVDSAAGSALFKGLDVDARFYFVHSYAAQRWEGSPDALLTWATYRAPF 172
           +   +PHMGWN +V       L  GLD +A  YFVHSY  +    +P   L    Y    
Sbjct: 124 QGLKVPHMGWNQLVPDGLSHPLLAGLDSEAHAYFVHSYKFE--PANPAHRLAHVEYGGQV 181

Query: 173 LAAVEDGALAATQFHPEKSGDAGAAVLSNWV 203
            A V    +  TQFHPEKS   G  V+SN++
Sbjct: 182 TAVVGRDNMVGTQFHPEKSQITGLKVISNFL 212


Lambda     K      H
   0.321    0.135    0.421 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 147
Number of extensions: 13
Number of successful extensions: 6
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 206
Length of database: 216
Length adjustment: 21
Effective length of query: 185
Effective length of database: 195
Effective search space:    36075
Effective search space used:    36075
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 45 (21.9 bits)

Align candidate WP_083763585.1 AMB_RS22935 (imidazole glycerol phosphate synthase subunit HisH)
to HMM TIGR01855 (hisH: imidazole glycerol phosphate synthase, glutamine amidotransferase subunit (EC 2.4.2.-))

Software error:

../bin/blast/fastacmd -i /tmp/list.17381.in -d ../tmp/orgsFit/orgs.faa -p T > /tmp/gapView.17381.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.

For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.