Align phosphoribosyl-ATP diphosphatase (EC 3.6.1.31) (characterized)
to candidate WP_011384788.1 AMB_RS12080 nucleoside triphosphate pyrophosphohydrolase
Query= metacyc::MONOMER-21148 (267 letters) >NCBI__GCF_000009985.1:WP_011384788.1 Length = 273 Score = 170 bits (431), Expect = 3e-47 Identities = 93/259 (35%), Positives = 145/259 (55%), Gaps = 3/259 (1%) Query: 10 RLTDVIDRLLAPEG-CPWDKEQTPESLCDYLVEECFELVEAIRSGNADEVREEMGDVMFL 68 RL ++ RL +P+G CPWD EQT ++ Y +EE +E+ EAI G+ ++++E+GD++F Sbjct: 9 RLLAIMARLRSPQGGCPWDLEQTFATIAPYTIEEAYEVAEAIEHGDMPQLKDELGDLLFQ 68 Query: 69 LAFLGRLYADKGAFTLDDAMANNAAKMIRRHPHVFSDTTYADRDEFLRNWESIKRAEK-A 127 + F ++ + G F D + + KMIRRHPHVF + D + WE K E+ A Sbjct: 69 VVFYAQMAKENGDFDFDAIASAISDKMIRRHPHVFVEDDGRDSAGQVEAWEETKARERAA 128 Query: 128 DAEGEPQGVYDSLPASLPPLLKAYRIHSKAARVGFTWPEDEDVERQVEAEWLELLDVLAG 187 A+G GV D + +LPP+ +A ++ ++AARVGF W E + ++ E E+ + + Sbjct: 129 KAKGANMGVLDGVARTLPPMTRALKLQNRAARVGFDWDRPETILDKLAEEAQEIAEEIRA 188 Query: 188 DDKAAQ-ENELGDLIFSLVELGRRKGIKANTALDMTNLKFLRRFRRMEALARERGLDFPA 246 + + E+E+GD++F V L R+ I AL N KF RRFR +E G A Sbjct: 189 EAPFDRLEDEMGDVLFVCVNLARKLNIDPERALKRANAKFERRFRHIETELNATGRTPQA 248 Query: 247 LSLDDKDELWNEAKAAEAA 265 +LD+ + LW AK E A Sbjct: 249 ATLDEMEALWQAAKTLEKA 267 Lambda K H 0.318 0.134 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 204 Number of extensions: 13 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 267 Length of database: 273 Length adjustment: 25 Effective length of query: 242 Effective length of database: 248 Effective search space: 60016 Effective search space used: 60016 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory