Align 2-isopropylmalate synthase 2; EC 2.3.3.13; Alpha-IPM synthase 2; Alpha-isopropylmalate synthase 2 (uncharacterized)
to candidate WP_011383972.1 AMB_RS07875 homocitrate synthase
Query= curated2:Q8RCF9 (384 letters) >NCBI__GCF_000009985.1:WP_011383972.1 Length = 381 Score = 324 bits (830), Expect = 3e-93 Identities = 163/356 (45%), Positives = 233/356 (65%) Query: 5 KDKPVYIVDTTLRDGEQTAGVVFANNEKIRIAQMLDEIGIDQLEVGIPTMGGDEKETVAK 64 K + + DTTLRDGEQTAGV F +EK+ IA+ LD G+ ++EVGIP MG +E+ + K Sbjct: 3 KAATIVMNDTTLRDGEQTAGVAFRLDEKLDIARTLDIAGVPEIEVGIPAMGAEEQAAIRK 62 Query: 65 IAKLGLKASIMAWNRAVVKDVQESLECGVDAVAISISTSDIHIEHKLKKTRQWVLDSMTE 124 +A LGLKA ++AW R + D++ + C V V +SI SD+ + K+ + R W L+ + Sbjct: 63 VAGLGLKARLIAWCRMMEDDLEAAALCDVATVNLSIPVSDLQLAAKMGRDRAWALEHIRV 122 Query: 125 AVRFAKKEGVYVSVNAEDASRTDMNFLIEFARCAKQAGADRLRFCDTVGFLDPFKTYEMV 184 V A+ G V V ED+SR D FL + R + AGA R RF DT+G +DPF ++ Sbjct: 123 MVGKARAMGFDVLVGGEDSSRADPAFLADVVRACEAAGAQRFRFADTMGIMDPFAVHDAF 182 Query: 185 KAIKDAVDIEIEMHTHNDFGMATANALAGVKAGAKFVGVTVNGLGERAGNAALEEVVMAL 244 +A++ A +E+E+H H+D G+ATAN+LA V+ GA V TVNGLGERAGNA LEEVV+AL Sbjct: 183 RALRAATSMELEIHAHDDLGLATANSLAAVRGGATHVSTTVNGLGERAGNAPLEEVVVAL 242 Query: 245 KYVYKMDLGIDTSRFREISEYVALASGRPLPPSKAIVGKNVFAHESGIHVDGALKNPYTY 304 ++Y + GID + +S+ VA ASGRP+P K+IVG+N+F HESGIHV G L++P TY Sbjct: 243 GHLYGRETGIDKRQLGRVSKLVAEASGRPVPVDKSIVGENIFTHESGIHVSGLLRDPRTY 302 Query: 305 EVFDPQEVGLERQIVIGKHSGTAALINKFKEYGRVLTEEEANLLLPHVRKMAIQLK 360 + DP E+G ++V+GKHSG ++++ +E G + +A +L VR+ A K Sbjct: 303 QALDPAELGRGHRLVLGKHSGLTSVLHACREIGLEVDAAKARAMLAQVRRHASTTK 358 Lambda K H 0.318 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 353 Number of extensions: 9 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 384 Length of database: 381 Length adjustment: 30 Effective length of query: 354 Effective length of database: 351 Effective search space: 124254 Effective search space used: 124254 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory