Align LL-diaminopimelate aminotransferase; DAP-AT; DAP-aminotransferase; LL-DAP-aminotransferase; EC 2.6.1.83 (characterized)
to candidate WP_011386083.1 AMB_RS18860 pyridoxal phosphate-dependent aminotransferase
Query= SwissProt::Q2RK33 (390 letters) >NCBI__GCF_000009985.1:WP_011386083.1 Length = 410 Score = 360 bits (923), Expect = e-104 Identities = 168/384 (43%), Positives = 247/384 (64%), Gaps = 3/384 (0%) Query: 6 RIRELPPYLFARIEKKIAEARERGVDIISLGIGDPDMPTPSHVIDKLVAEAHNPENHRYP 65 RI+ LPPY+FA + A AR G DII G+G+PD PTP+H++DKLV A NP HRY Sbjct: 9 RIKRLPPYVFAEVNAMKARARAAGEDIIDFGMGNPDQPTPAHIVDKLVEAARNPRAHRYS 68 Query: 66 TSEGLLAFRQAVADWYQRLYGVDLDPRREVVTLIGSKEGIAHISLCYVDPGDINLVPDPG 125 S G+ R+A++ +YQR + VD+DP E + +GSKEG+A+++ PGDI LVP+P Sbjct: 69 MSRGIPGLRKALSGYYQRRFAVDIDPETECIVTLGSKEGLANLANAITSPGDIVLVPNPS 128 Query: 126 YPVYNIGTLLAGGESYFMPLTAANGFLPDLGAIPSDVARRAKLMFINYPNNPTGAVADLK 185 YP++ G ++AGG F+P+T FL L + + +NYP+NPT +ADL Sbjct: 129 YPIHPYGFIIAGGSCRFVPVTPDAEFLKALDRAVRHSVPKPIALVLNYPSNPTALLADLD 188 Query: 186 FFQEVVEFARSYDLIVCHDAAYSEITYDGYRAPSFLQAPGAKEVGIEFNSVSKPYNMTGW 245 F+ +VVEF R + + + D AYSEI +D PS LQ PGAKE+ +EF S+SK YNM GW Sbjct: 189 FYGQVVEFCRHHGIWILSDLAYSEIYFDVAPPPSILQIPGAKEIAVEFTSMSKTYNMPGW 248 Query: 246 RLGWACGRADVIEALARIKSNIDSGAFQAVQYAGIAALTGPQEGLAEVRRVYQERRDIIV 305 R+G+A G +I AL RIKS +D GAF +Q A AAL GPQ+ + ++R +Y+ RRD ++ Sbjct: 249 RIGFAAGNKTLIAALGRIKSYLDYGAFTPIQVAATAALNGPQDCVDDIRALYKGRRDALI 308 Query: 306 EGFNSLGWHLEKPKATFYVWAPVPRGYT---SASFAEMVLEKAGVIITPGNGYGNYGEGY 362 EG ++ GW + P AT + WAP+P+ + S F+++++ +A V + PG G+G YG+ + Sbjct: 309 EGLSAAGWEIPSPPATMFAWAPIPKAFAHLGSLEFSKLLMREAQVAVAPGIGFGEYGDSH 368 Query: 363 FRIALTISKERMQEAIERLRRVLG 386 RI L + +R ++A+ ++ LG Sbjct: 369 VRIGLVENVQRTRQAVRNIKTFLG 392 Lambda K H 0.320 0.139 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 458 Number of extensions: 16 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 390 Length of database: 410 Length adjustment: 31 Effective length of query: 359 Effective length of database: 379 Effective search space: 136061 Effective search space used: 136061 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory