Align 4-hydroxy-tetrahydrodipicolinate synthase (EC 4.3.3.7) (characterized)
to candidate WP_011384687.1 AMB_RS11575 dihydrodipicolinate synthase family protein
Query= BRENDA::P19808 (301 letters) >NCBI__GCF_000009985.1:WP_011384687.1 Length = 338 Score = 95.9 bits (237), Expect = 1e-24 Identities = 87/293 (29%), Positives = 139/293 (47%), Gaps = 21/293 (7%) Query: 21 MVTPFTESGDIDIAAGREVAAYLVDKGLDSLVLAGTTGESPTTTAAEKLELLKAVREEVG 80 ++TPFT + + +A +L+ +GL L GTT E + EK+ELL A+ E Sbjct: 52 ILTPFTNALTPHVPLFVGLAHHLMGQGL-GLAPFGTTSEGNSLGVEEKVELLDALAEIGL 110 Query: 81 DRAKLIAGVGTNNTRTSVELAEAAASAGADGLLVVTP-YYSKPSQEGLLAHFGAI---AA 136 + A+++ G G SV L A + G G+L++ P YY PS++GL A F + Sbjct: 111 NMARVMPGTGCCALTDSVTLTSHAVNLGCGGVLMLPPFYYKNPSEDGLFASFAEVIERVG 170 Query: 137 ATEVPICLYDIPGRSGIPIESDTMRRL--SELPTILAVKDAKGDLVAATSLIKE-TGLAW 193 + + + LY P +S IPI + RL + T++ +KD+ GDL + + G Sbjct: 171 DSRLRVYLYHFPQQSQIPISHGLIERLLAAYPTTVVGIKDSSGDLANMEGMCRAFPGFKV 230 Query: 194 YSGDDPLNLVWLALGGSGFISVIGHAAPTALRELYTSFEEGDLVRAREINAKLSPLVAAQ 253 +SG + L L + GG+G IS + A+ EL+ + E + A L + Sbjct: 231 FSGTERLILPVMRAGGAGCISANANIHGPAMLELWRRWRE------PQAEALQKDLEGFR 284 Query: 254 GRLGGVSLAKAALRLQGINVGD-----PRLPIMA-PNEQELEALREDMKKAGV 300 + G+ L A L GD R P+MA P + E+E L + + KAG+ Sbjct: 285 AIMEGMPLIAALKALTARRTGDYGWRRVRPPLMALPPDAEIE-LVDRLAKAGI 336 Lambda K H 0.314 0.133 0.369 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 235 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 301 Length of database: 338 Length adjustment: 28 Effective length of query: 273 Effective length of database: 310 Effective search space: 84630 Effective search space used: 84630 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory