Align O-acetylhomoserine sulfhydrylase (EC:2.5.1.49) (characterized)
to candidate WP_011383705.1 AMB_RS06585 cystathionine beta-lyase
Query= reanno::Korea:Ga0059261_3194 (402 letters) >NCBI__GCF_000009985.1:WP_011383705.1 Length = 390 Score = 145 bits (366), Expect = 2e-39 Identities = 109/342 (31%), Positives = 163/342 (47%), Gaps = 16/342 (4%) Query: 61 QGMTYSRLQNPTVEMLEQRIALLEGAEACRATASGMAAMTAALLCQLSAGDHLIGGRAAF 120 +G+ Y R PT LE+ +A LEG AT+SG+AA+T ALL L AGDHL+ + Sbjct: 48 EGVRYGRFGTPTTFALEEAVAELEGGHRTVATSSGLAAITGALLAFLKAGDHLLMVDTTY 107 Query: 121 GSCRWLTDTQLPKFGIETTVVDARDPQQFIDAIRPNTKVFFFETPANPTMDVVDLKAVCA 180 R D+ L GIETT D +RPNT+V F E+P + T +V D+ A+ Sbjct: 108 FPTRKFCDSVLGGLGIETTYYDPLVGAGITALMRPNTRVVFTESPGSLTFEVQDIPAIAE 167 Query: 181 IARERGIVTVVDNAFATPALQRPMDFGADVVAYSATKMMDGQGRVLAGAV-CGTEEF--- 236 A G V ++DN + Q P G D+ +ATK + G + G + T E Sbjct: 168 AAHAGGAVVMMDNTWGVLHFQ-PFTKGIDISIQAATKYIVGHADAMLGTITAATPELWLQ 226 Query: 237 INNTLLPFHRNTGPTLSPFNAWVVLKGLETLDLRIQRQSENALKVARFLEGR--VPRVNF 294 + +L F + G ++ L+GL TL +R+++ +E+AL++ R+LE R V RV + Sbjct: 227 VKTSLAAFGASPGTE----EMYLGLRGLRTLPVRLRQHAESALRLTRWLEARPEVDRVLY 282 Query: 295 PGLPSHPQHNLAMSQMAAAGPIFSIEL-DGGRTQAHGLLDALGLIDISNNIGDSRSLMTH 353 P L S P H L +F + L + +LD + + G SL+ Sbjct: 283 PPLASDPGHELWKRDFTGGCGLFGVILKPASKAAVDAMLDGYSHFKLGFSWGGFESLV-- 340 Query: 354 PASTTHSGVAEDQRLLMGVGEGMLRLNVGLEDPEDLIADLDQ 395 T+ + VG LR + GLED +DL DL++ Sbjct: 341 -IPTSGHSIIRTATPWTPVGPS-LRFHAGLEDADDLEEDLER 380 Lambda K H 0.319 0.134 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 346 Number of extensions: 14 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 402 Length of database: 390 Length adjustment: 31 Effective length of query: 371 Effective length of database: 359 Effective search space: 133189 Effective search space used: 133189 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory