Align branched-chain-amino-acid transaminase (EC 2.6.1.42); glutamate-prephenate aminotransferase (EC 2.6.1.79) (characterized)
to candidate WP_043743277.1 AMB_RS02850 branched-chain amino acid aminotransferase
Query= BRENDA::P54691 (305 letters) >NCBI__GCF_000009985.1:WP_043743277.1 Length = 290 Score = 135 bits (340), Expect = 1e-36 Identities = 86/268 (32%), Positives = 140/268 (52%), Gaps = 19/268 (7%) Query: 9 YFEDKFVPFEDAKISVATHALHYGTAAFGGLRGIPDPEDPGTILLFRLDRHGDRLSKSAK 68 +F+ K VP+ DAKI V TH LHYG+ F G R +F+L H RL S + Sbjct: 14 WFDGKLVPWRDAKIHVLTHGLHYGSCVFEGERVYGGK-------VFKLREHSQRLIDSGR 66 Query: 69 FLHYDI--SAEKIKEVIVDFVKKNQPDKSFYIRPLVY--SSGLGIAPRLHNLEKDFLVYG 124 L +++ + E+I E + VK N Y+RP+ + S +G+A + + F V Sbjct: 67 ILGFEVPWTVEEIDEATMATVKANNIVDG-YVRPVAWRGSEMMGVAAQTTKIR--FAVAT 123 Query: 125 LEMGDYLAAD----GVSCRISSWYRQEDRSFPLRGKISAAYITSALAKTEAVESGFDEAI 180 Y + + G+ IS+W R + P K + Y+ ++K +A G+++++ Sbjct: 124 WSWPSYWSPEARMKGIRLNISTWKRPHPETAPTASKAAGLYMICTMSKHKAEGDGYEDSL 183 Query: 181 LMNSQGKVCEATGMNVFMVRNGQIVTPGNEQDILEGITRDSILTIAADLGIPTCQRPIDK 240 +++ +G+V EATG N+F V ++ TP L GITR +++ +A GI +R I Sbjct: 184 MLDWRGQVAEATGANIFFVFGNELHTP-TPDCFLNGITRQTVIALAKKRGITVVERAIFP 242 Query: 241 SELMIADEVFLSGTAAKITPVKRIENFT 268 E+ A E FL+GTAA++TPV+ I +T Sbjct: 243 EEMTKASECFLTGTAAEVTPVREIGPYT 270 Lambda K H 0.320 0.138 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 212 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 305 Length of database: 290 Length adjustment: 26 Effective length of query: 279 Effective length of database: 264 Effective search space: 73656 Effective search space used: 73656 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory