Align Aspartate-semialdehyde dehydrogenase 2; ASA dehydrogenase 2; ASADH 2; Aspartate-beta-semialdehyde dehydrogenase 2; EC 1.2.1.11 (characterized)
to candidate WP_011383030.1 AMB_RS03035 aspartate-semialdehyde dehydrogenase
Query= SwissProt::P23247 (337 letters) >lcl|NCBI__GCF_000009985.1:WP_011383030.1 AMB_RS03035 aspartate-semialdehyde dehydrogenase Length = 338 Score = 332 bits (850), Expect = 1e-95 Identities = 173/334 (51%), Positives = 233/334 (69%), Gaps = 3/334 (0%) Query: 5 FNVAIFGATGAVGETMLEVLQEREFPVDELFLLASERSEGKTYRFNGKTVRVQNVEEFDW 64 + VA+ GATG VG ML++L +R+FP DE+ LASERS G+ + K ++ +++ FD+ Sbjct: 3 YKVAVIGATGNVGRAMLQILVDRKFPADEVVALASERSVGREVSYGDKVLKCKDLATFDF 62 Query: 65 SQVHIALFSAGGELSAKWAPIAAEAGVVVIDNTSHFRYDYDIPLVVPEVNPEAIAEFRNR 124 IAL S G ++SA +P AA AG VVIDNTSHFR + D+PLVVPEVNP+AIA+++ R Sbjct: 63 KGCDIALSSPGAKVSAIHSPRAAAAGCVVIDNTSHFRMEPDVPLVVPEVNPDAIAQYKKR 122 Query: 125 NIIANPNCSTIQMLVALKPIYDAVGIERINVTTYQSVSGAGKAGIDELAGQTAKLLNGYP 184 IIANPNCSTIQM+VALKP++ I+R+ V+TYQSVSGAGK G+DEL QT +L Sbjct: 123 GIIANPNCSTIQMVVALKPLHKLGKIKRVVVSTYQSVSGAGKEGMDELYDQTKGILVHDA 182 Query: 185 AETNTFSQQIAFNCIPQIDQFMDNGYTKEEMKMVWETQKIFNDPSIMVNPTCVRVPVFYG 244 + F++QIAFN IPQID FM++G TKEE KMV ET KI DP I VN TCVRVPVF Sbjct: 183 IKPQKFAKQIAFNLIPQIDVFMEDGSTKEEWKMVVETHKIL-DPDIAVNATCVRVPVFVS 241 Query: 245 HAEAVHVETRAPIDAEQVMDMLEQTDGIELFRGADFPTQVR--DAGGKDHVLVGRVRNDI 302 H+E+++VE P+ + + L + +G+ + + + D G+D V + R+R D Sbjct: 242 HSESINVEFERPVSVAEATEALREAEGVVVMDTREPGGYITPLDTTGEDPVYISRIRKDP 301 Query: 303 SHHSGINLWVVADNVRKGAATNAVQIAELLVRDY 336 + +G++ W VADN+RKGAA NAVQIAE+L+RDY Sbjct: 302 TVKNGLSFWCVADNLRKGAALNAVQIAEVLIRDY 335 Lambda K H 0.319 0.135 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 320 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 337 Length of database: 338 Length adjustment: 28 Effective length of query: 309 Effective length of database: 310 Effective search space: 95790 Effective search space used: 95790 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate WP_011383030.1 AMB_RS03035 (aspartate-semialdehyde dehydrogenase)
to HMM TIGR01296 (asd: aspartate-semialdehyde dehydrogenase (EC 1.2.1.11))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01296.hmm # target sequence database: /tmp/gapView.6163.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01296 [M=339] Accession: TIGR01296 Description: asd_B: aspartate-semialdehyde dehydrogenase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4e-145 469.1 0.5 4.5e-145 468.9 0.5 1.0 1 lcl|NCBI__GCF_000009985.1:WP_011383030.1 AMB_RS03035 aspartate-semialdehy Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000009985.1:WP_011383030.1 AMB_RS03035 aspartate-semialdehyde dehydrogenase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 468.9 0.5 4.5e-145 4.5e-145 1 338 [. 4 333 .. 4 334 .. 0.99 Alignments for each domain: == domain 1 score: 468.9 bits; conditional E-value: 4.5e-145 TIGR01296 1 nvaivGatGavGqellkvLeernfpidklvllasersaGkkvkfkgkeleveeaekesfegidialfsa 69 +va++GatG+vG+ +l++L +r+fp+d++v+lasers G++v + +k l+ +++ +++f+g dial s lcl|NCBI__GCF_000009985.1:WP_011383030.1 4 KVAVIGATGNVGRAMLQILVDRKFPADEVVALASERSVGREVSYGDKVLKCKDLATFDFKGCDIALSSP 72 69******************************************************************* PP TIGR01296 70 GgsvskefapkaakagviviDntsafrldedvPLvvpevnaeelkeakkkgiianPnCstiqlvvvLkp 138 G+ vs p+aa+ag++viDnts fr+++dvPLvvpevn + +++ kk+giianPnCstiq+vv+Lkp lcl|NCBI__GCF_000009985.1:WP_011383030.1 73 GAKVSAIHSPRAAAAGCVVIDNTSHFRMEPDVPLVVPEVNPDAIAQYKKRGIIANPNCSTIQMVVALKP 141 ********************************************************************* PP TIGR01296 139 lkdeaklkrvvvstYqavsGaGkkgveeLknqtkavlegkekepeidalkakkfakqiafnaiplidkl 207 l++ k+krvvvstYq+vsGaGk+g++eL++qtk +l+ ++ ++kfakqiafn+ip+id + lcl|NCBI__GCF_000009985.1:WP_011383030.1 142 LHKLGKIKRVVVSTYQSVSGAGKEGMDELYDQTKGILVHDAIK-------PQKFAKQIAFNLIPQIDVF 203 ************************************9876655.......6****************** PP TIGR01296 208 kedGytkeelkllfetrkilgiedlkvsatcvrvPvftghsesvsiefekelsveevkelLkeapgvvv 276 +edG tkee k++ et+kil+ +d+ v atcvrvPvf++hses+++efe+++sv e+ e L+ea+gvvv lcl|NCBI__GCF_000009985.1:WP_011383030.1 204 MEDGSTKEEWKMVVETHKILD-PDIAVNATCVRVPVFVSHSESINVEFERPVSVAEATEALREAEGVVV 271 *********************.*********************************************** PP TIGR01296 277 iddpsenlyptPleavgkdevfvgrirkDlskekglalfvvaDnlrkGaalnavqiaellik 338 +d + y+tPl+++g+d v+++rirkD + ++gl+ ++vaDnlrkGaalnavqiae li+ lcl|NCBI__GCF_000009985.1:WP_011383030.1 272 MDTREPGGYITPLDTTGEDPVYISRIRKDPTVKNGLSFWCVADNLRKGAALNAVQIAEVLIR 333 ***********************************************************997 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (339 nodes) Target sequences: 1 (338 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 6.73 // [ok]
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory