Align phosphoribosylanthranilate isomerase (EC 5.3.1.24) (characterized)
to candidate WP_011385240.1 AMB_RS14415 indole-3-glycerol phosphate synthase TrpC
Query= BRENDA::P00909 (453 letters) >NCBI__GCF_000009985.1:WP_011385240.1 Length = 271 Score = 152 bits (385), Expect = 1e-41 Identities = 100/261 (38%), Positives = 141/261 (54%), Gaps = 8/261 (3%) Query: 4 TVLAKIVADKAIWVEARKQQQPLASFQNEVQPST--RHFYDALQGART----AFILECKK 57 T+L +I ++K V +K ++P+ Q R F +L I E KK Sbjct: 6 TILDRICSEKRKQVAEQKSRRPIQELLKRAQDQAPPRGFAASLDRKVAEIGWGLITEIKK 65 Query: 58 ASPSKGVIRDDFDPARIAAIYKHYASA-ISVLTDEKYFQGSFNFLPIVSQIAPQPILCKD 116 ASPS G+IR DF P +A Y+ +A +SVLTD+K+FQG+ L P+L KD Sbjct: 66 ASPSAGIIRADFKPEFLARAYQRGGAACLSVLTDQKFFQGTDADLGAARSACDIPVLRKD 125 Query: 117 FIIDPYQIYLARYYQADACLLMLSVLDDDQYRQLAAVAHSLEMGVLTEVSNEEEQERAIA 176 F++DPYQI AR AD LL+++ L D + Q+ +A M VL EV +E E ERA+ Sbjct: 126 FMVDPYQIVEARALGADCILLIVASLTDAELSQMEDIALGYGMDVLIEVHDEAELERALK 185 Query: 177 LGAKVVGINNRDLRDLSIDLNRTRELAPKLGHNVTVISESGINTYAQVRELSHF-ANGFL 235 L + ++GINNRDLR + DL T L P + V+SESG+ +R ++ FL Sbjct: 186 LKSPLIGINNRDLRIMKTDLATTERLVPLIPAGKVVVSESGLEGPGDLRRMAAVGVKRFL 245 Query: 236 IGSALMAHDDLHAAVRRVLLG 256 IG ALM D+ AV+ +L G Sbjct: 246 IGEALMRRPDVEQAVKVLLAG 266 Lambda K H 0.320 0.135 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 240 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 453 Length of database: 271 Length adjustment: 29 Effective length of query: 424 Effective length of database: 242 Effective search space: 102608 Effective search space used: 102608 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory