Align Tryptophan synthase beta chain 1; EC 4.2.1.20 (characterized, see rationale)
to candidate WP_083763485.1 AMB_RS09050 TrpB-like pyridoxal phosphate-dependent enzyme
Query= uniprot:P50383 (425 letters) >NCBI__GCF_000009985.1:WP_083763485.1 Length = 475 Score = 418 bits (1074), Expect = e-121 Identities = 210/418 (50%), Positives = 289/418 (69%), Gaps = 6/418 (1%) Query: 1 MVKEDEILPKYWYNIIPDLPKPLPPPRDPQGAYFSRIDLLRSILPKEVLRQQFTIERYIK 60 ++ ED LPK WYN+ DLP P PPP P D L I P V+ Q+ T ER+++ Sbjct: 31 LLSEDR-LPKAWYNLNADLPVPAPPPLHPGTGQPIGPDDLAPIFPMAVIAQEVTAERWVE 89 Query: 61 IPEEVRDRYLSIGRPTPLFRAKRLEEYLKTPARIYFKYEGATPTGSHKINTAIPQAYFAK 120 IPE VR+ Y + RP PL RA+RLE+ L TPARIYFKYEG +P GSHK NT++PQA++ + Sbjct: 90 IPEPVREVY-RLWRPAPLIRARRLEKALGTPARIYFKYEGVSPAGSHKPNTSVPQAFYNQ 148 Query: 121 EEGIEHVVTETGAGQWGTAVALAASMYNMKSTIFMVKVSYEQKPMRRSIMQLYGANVYAS 180 +EG++ + TETGAGQWG+++A A S++ ++ +FMVKVSYEQKP RR++M+ YGA AS Sbjct: 149 QEGVKRLATETGAGQWGSSLAFAGSLFGLEVEVFMVKVSYEQKPYRRALMETYGAKCIAS 208 Query: 181 PTNLTEYGRKILETNPQHPGSLGIAMSEAIEYAL-KNEFRYLVGSVLDVVLLHQSVIGQE 239 P+NLT GR ILE +P GSLGIA+SEA+E A +++ +Y +GSVL+ V LHQ++IG+E Sbjct: 209 PSNLTHAGRSILEKDPHSNGSLGIAISEAVEIAASRDDTKYALGSVLNHVCLHQTIIGEE 268 Query: 240 TITQLDLLGEDADILIGCVGGGSNFGGFTYPFI-GNKKG--KRYIAVSSAEIPKFSKGEY 296 + Q+++ + D++I C GGGSNF G +P+I N KG R I V A P +KG Y Sbjct: 269 AMMQMEMADDHPDVVIACTGGGSNFAGLAFPYIRENLKGGKTRVIGVEPASCPTLTKGLY 328 Query: 297 KYDFPDSAGLLPLVKMITLGKDYVPPPIYAGGLRYHGVAPTLSLLTKEGIVEWREYNERE 356 YDF D+ L PLVKM TLG ++PP +AGGLRYHG+AP +S + + G++E R Y++ E Sbjct: 329 AYDFGDTGKLTPLVKMHTLGATFMPPGSHAGGLRYHGMAPMVSHVKELGLMEARAYHQTE 388 Query: 357 IFEAAKIFIENQGIVPAPESAHAIRAVVDEAIEARKNNERKVIVFNLSGHGLLDLSNY 414 F AA F +GIVPAPES+HA++ +DEA+ + + + I+FNLSGHG D+ Y Sbjct: 389 CFAAAVQFARAEGIVPAPESSHAVKGAIDEALRCKAEGKAETILFNLSGHGHFDMQAY 446 Lambda K H 0.318 0.138 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 515 Number of extensions: 28 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 425 Length of database: 475 Length adjustment: 33 Effective length of query: 392 Effective length of database: 442 Effective search space: 173264 Effective search space used: 173264 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory