Align Anthranilate phosphoribosyltransferase; EC 2.4.2.18 (characterized)
to candidate WP_011385239.1 AMB_RS14410 anthranilate phosphoribosyltransferase
Query= SwissProt::P83827 (329 letters) >NCBI__GCF_000009985.1:WP_011385239.1 Length = 346 Score = 260 bits (665), Expect = 3e-74 Identities = 162/335 (48%), Positives = 204/335 (60%), Gaps = 15/335 (4%) Query: 3 AVKKAILGEV-----LEEEEAYEVMRALMAGEVSPVRAAGLLVALSLRGERPHEIAAMAR 57 A+ K ILG V L E +A EV +M+G+ +P + GLL+ L +RGE EI AR Sbjct: 9 ALMKEILGRVAVGASLSETQAEEVFEIIMSGDATPAQIGGLLLGLRVRGETVEEITGAAR 68 Query: 58 AMREAARPLRVHRRP-LLDIVGTGGDGKGLMNLSTLAALVAAAGGVAVAKHGNRAASSRA 116 MR A+ L++ P +DIVGTGGD G N+ST A+ V AA GV VAKHGNRA SS++ Sbjct: 69 IMR--AKALKIEAPPGSVDIVGTGGDEAGTFNISTAASFVVAACGVPVAKHGNRAVSSKS 126 Query: 117 GSADLLEALGVDLEAPPERVGEAIEELGFGFLFARVFHPAMRHVAPVRAELGVRTVFNLL 176 G++D+L ALGV+++A V E + E GFL A H AMRHVA R ELG RT+FNLL Sbjct: 127 GASDVLTALGVNIDADFALVHETLWENKVGFLMAPRHHNAMRHVAGPRGELGTRTIFNLL 186 Query: 177 GPLTNPAGADAYVLGVFSPEWLAPMAEALERLGA-RGLVVHG-EGADEL-VLGENRVVEV 233 GPL+NPAG V+GVF+ W+ P+A L RLGA VVHG +G DEL G RV E Sbjct: 187 GPLSNPAGTTRQVVGVFAERWVEPLARVLGRLGAEHAWVVHGTDGLDELTTTGPTRVAEY 246 Query: 234 GKG---AYALTPEEVGLKRAPLEALKGGGPEENAALARRLLKGEEKGPLADAVALAAGAG 290 G +++TPEEVGLKRA LKGG NAA + LLKGE+ G D V L A A Sbjct: 247 KGGEVRLFSVTPEEVGLKRAAPADLKGGDSATNAAAMKALLKGEQ-GAYRDIVVLNAAAA 305 Query: 291 FYAAGKTPSLKEGVALAREVLASGEAYLLLERYVA 325 AGK +L +G A + + GEA +L R +A Sbjct: 306 LVVAGKVDTLGDGARAAEQAIDRGEAEAVLHRMIA 340 Lambda K H 0.317 0.136 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 358 Number of extensions: 21 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 329 Length of database: 346 Length adjustment: 28 Effective length of query: 301 Effective length of database: 318 Effective search space: 95718 Effective search space used: 95718 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
Align candidate WP_011385239.1 AMB_RS14410 (anthranilate phosphoribosyltransferase)
to HMM TIGR01245 (trpD: anthranilate phosphoribosyltransferase (EC 2.4.2.18))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01245.hmm # target sequence database: /tmp/gapView.30369.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01245 [M=330] Accession: TIGR01245 Description: trpD: anthranilate phosphoribosyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6e-122 393.0 0.8 6.8e-122 392.8 0.8 1.0 1 lcl|NCBI__GCF_000009985.1:WP_011385239.1 AMB_RS14410 anthranilate phospho Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000009985.1:WP_011385239.1 AMB_RS14410 anthranilate phosphoribosyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 392.8 0.8 6.8e-122 6.8e-122 3 329 .. 17 340 .. 15 341 .. 0.98 Alignments for each domain: == domain 1 score: 392.8 bits; conditional E-value: 6.8e-122 TIGR01245 3 klldnkdLseeeaeqlmkeimsgeasdaqiaAilvalrvkgeteeeiaglakalrekakkvekeeseel 71 +++ + +Lse++ae++++ imsg+a++aqi+ +l lrv+get+eei+g+a+++r+ka k+e+ lcl|NCBI__GCF_000009985.1:WP_011385239.1 17 RVAVGASLSETQAEEVFEIIMSGDATPAQIGGLLLGLRVRGETVEEITGAARIMRAKALKIEA--PPGS 83 5666789******************************************************88..6999 PP TIGR01245 72 vDivGTGGDglktiNiSTasalvaaaaGvkvaKhGnrsvssksGsaDvLealgvnlelspekvarslee 140 vDivGTGGD++ t+NiSTa+++v+aa+Gv+vaKhGnr+vssksG++DvL algvn++++ + v+++l e lcl|NCBI__GCF_000009985.1:WP_011385239.1 84 VDIVGTGGDEAGTFNISTAASFVVAACGVPVAKHGNRAVSSKSGASDVLTALGVNIDADFALVHETLWE 152 ********************************************************************* PP TIGR01245 141 vgigFlfAPkyhpalkevapvRkeLgvrtvfNlLGPLlnParaklqvlGvyskdlvevlaevlknlgvk 209 + +gFl+AP++h+a+++va+ R eLg+rt+fNlLGPL+nPa ++qv+Gv+ + ve la+vl +lg++ lcl|NCBI__GCF_000009985.1:WP_011385239.1 153 NKVGFLMAPRHHNAMRHVAGPRGELGTRTIFNLLGPLSNPAGTTRQVVGVFAERWVEPLARVLGRLGAE 221 ********************************************************************* PP TIGR01245 210 ralvvhgedglDEisltgetkvaelkdgeieeytlspedfglkraeleelkggsaeenaellkevlegk 278 +a vvhg dglDE+++tg+t+vae k ge++ ++++pe+ glkra +lkgg+ + na+++k++l+g+ lcl|NCBI__GCF_000009985.1:WP_011385239.1 222 HAWVVHGTDGLDELTTTGPTRVAEYKGGEVRLFSVTPEEVGLKRAAPADLKGGDSATNAAAMKALLKGE 290 ****************************************************************99999 PP TIGR01245 279 ekkakrdivvlNaaaalyvagkakdlkegvelakeaiksgkalekleelva 329 + +a rdivvlNaaaal+vagk+++l +g+++a++ai+ g+a ++l++++a lcl|NCBI__GCF_000009985.1:WP_011385239.1 291 Q-GAYRDIVVLNAAAALVVAGKVDTLGDGARAAEQAIDRGEAEAVLHRMIA 340 8.9*******************************************99875 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (330 nodes) Target sequences: 1 (346 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 10.40 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory