Align L-leucine transaminase; L-isoleucine transaminase (EC 2.6.1.42) (characterized)
to candidate WP_011383786.1 AMB_RS06965 PLP-dependent aminotransferase family protein
Query= reanno::acidovorax_3H11:Ac3H11_1358 (401 letters) >NCBI__GCF_000009985.1:WP_011383786.1 Length = 547 Score = 133 bits (334), Expect = 1e-35 Identities = 98/286 (34%), Positives = 140/286 (48%), Gaps = 10/286 (3%) Query: 79 GYAPLRQAIADFLPWD----VDADQILITTGSQQALDLIAKVLIDENSRVLVETPTYLGA 134 G+APLR AIA+ L D Q++I GSQQALDL+A+VL++ VLVE P Y G Sbjct: 227 GHAPLRHAIAEHLGRSRAVRCDPAQVMIMGGSQQALDLVARVLLEPGEAVLVEDPCYGGL 286 Query: 135 LQAFTPMEPSVVAVASDDEGVLIDDLKAKVGTGADKARFLYVLPNFQNPTGRTMTEARRA 194 V AVA D +G D A+ AR +V P+ Q PTG TM +RR Sbjct: 287 TGVLRAAGAQVQAVAVDGQG--FDPELAE--RQCPSARLTFVTPSHQFPTGATMPLSRRL 342 Query: 195 ALVKAAAELNLPLVEDNPYGDLWFDNPPPAPLTARNPEG-CIYMGSFSKVLAPGLRLGFV 253 AL+ A + ++ED+ D P A L + G +Y+G+FSK + PGLRLG++ Sbjct: 343 ALIHWAERVGGWVIEDDYDSDFHHAGSPTASLQGLDRGGRTLYLGTFSKSMFPGLRLGWL 402 Query: 254 VAPKAVYPKLLQAKQAADLHTPGYNQRLVAEVMKGNFLDRHVPTIRALYKQQCEAMLAAL 313 V P + P + A++ AD+ G Q +A M H+ +R LY Q+ A+L A Sbjct: 403 VVPPPLLPAFVAARRIADMAPAGLTQAAMAAFMTEGHFGAHLRRMRTLYGQRRRALLDA- 461 Query: 314 TQEMAGLGVEWNRPDGGMFLWVRLPEGMSAIELLPQAVERNVAFVP 359 + G + + G+ + LP G + A R +A P Sbjct: 462 APRILGPNLPVTAGEAGLHAILWLPAGCDDFQAAEAARARGLAPSP 507 Lambda K H 0.318 0.134 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 543 Number of extensions: 33 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 401 Length of database: 547 Length adjustment: 33 Effective length of query: 368 Effective length of database: 514 Effective search space: 189152 Effective search space used: 189152 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory