GapMind for Amino acid biosynthesis

 

Alignments for a candidate for ilvE in Magnetospirillum magneticum AMB-1

Align Branched-chain amino acid aminotransferase (EC 2.6.1.42) (characterized)
to candidate WP_043743277.1 AMB_RS02850 branched-chain amino acid aminotransferase

Query= reanno::BFirm:BPHYT_RS16285
         (307 letters)



>NCBI__GCF_000009985.1:WP_043743277.1
          Length = 290

 Score =  239 bits (609), Expect = 7e-68
 Identities = 124/289 (42%), Positives = 177/289 (61%), Gaps = 8/289 (2%)

Query: 5   DRDGKIWMDGKLIDWRDAKIHVLTHTLHYGMGVFEGVRAYKTADGGTAIFRLQEHTKRLL 64
           DRDG +W DGKL+ WRDAKIHVLTH LHYG  VFEG R Y     G  +F+L+EH++RL+
Sbjct: 8   DRDGFLWFDGKLVPWRDAKIHVLTHGLHYGSCVFEGERVY-----GGKVFKLREHSQRLI 62

Query: 65  NSAKIFQMDVPFDHETLAAAQCEVVRENKLESCYLRPIIWVGSEKLGVSAKGNTIHVAIA 124
           +S +I   +VP+  E +  A    V+ N +   Y+RP+ W GSE +GV+A+   I  A+A
Sbjct: 63  DSGRILGFEVPWTVEEIDEATMATVKANNIVDGYVRPVAWRGSEMMGVAAQTTKIRFAVA 122

Query: 125 AWPWGAYLGEDGIAKGIRVKTSSFTRHHVNVSMVRAKASGWYVNSILANQEAIADGYDEA 184
            W W +Y   +   KGIR+  S++ R H   +   +KA+G Y+   ++  +A  DGY+++
Sbjct: 123 TWSWPSYWSPEARMKGIRLNISTWKRPHPETAPTASKAAGLYMICTMSKHKAEGDGYEDS 182

Query: 185 LLLDVDGYVSEGSGENFFLVNNGKLYTPDLSSCLDGITRDTVITLARDAGIQVIEKRITR 244
           L+LD  G V+E +G N F V   +L+TP     L+GITR TVI LA+  GI V+E+ I  
Sbjct: 183 LMLDWRGQVAEATGANIFFVFGNELHTPTPDCFLNGITRQTVIALAKKRGITVVERAIFP 242

Query: 245 DEVYTCDEAFFTGTAAEVTPIRELDNRTIGSGARGPITEKLQSGFFDIV 293
           +E+    E F TGTAAEVTP+RE+   T      G IT +L + +  +V
Sbjct: 243 EEMTKASECFLTGTAAEVTPVREIGPYTF---TPGDITRQLITDYDALV 288


Lambda     K      H
   0.319    0.136    0.411 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 286
Number of extensions: 9
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 307
Length of database: 290
Length adjustment: 27
Effective length of query: 280
Effective length of database: 263
Effective search space:    73640
Effective search space used:    73640
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 48 (23.1 bits)

Align candidate WP_043743277.1 AMB_RS02850 (branched-chain amino acid aminotransferase)
to HMM TIGR01122 (ilvE: branched-chain amino acid aminotransferase (EC 2.6.1.42))

Software error:

../bin/blast/fastacmd -i /tmp/list.17587.in -d ../tmp/orgsFit/orgs.faa -p T > /tmp/gapView.17587.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.

For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.