GapMind for catabolism of small carbon sources

 

Protein 350017 in Bacteroides thetaiotaomicron VPI-5482

Annotation: BT0489 putative gluconate aldolase (NCBI ptt file)

Length: 223 amino acids

Source: Btheta in FitnessBrowser

Candidate for 13 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
D-cellobiose catabolism eda hi 2-dehydro-3-deoxy-phosphogluconate aldolase (EC 4.1.2.14) (characterized) 52% 100% 260
D-galacturonate catabolism eda hi 2-dehydro-3-deoxy-phosphogluconate aldolase (EC 4.1.2.14) (characterized) 52% 100% 260
D-gluconate catabolism eda hi 2-dehydro-3-deoxy-phosphogluconate aldolase (EC 4.1.2.14) (characterized) 52% 100% 260
D-glucose catabolism eda hi 2-dehydro-3-deoxy-phosphogluconate aldolase (EC 4.1.2.14) (characterized) 52% 100% 260
D-glucuronate catabolism eda hi 2-dehydro-3-deoxy-phosphogluconate aldolase (EC 4.1.2.14) (characterized) 52% 100% 260
lactose catabolism eda hi 2-dehydro-3-deoxy-phosphogluconate aldolase (EC 4.1.2.14) (characterized) 52% 100% 260
D-maltose catabolism eda hi 2-dehydro-3-deoxy-phosphogluconate aldolase (EC 4.1.2.14) (characterized) 52% 100% 260
myo-inositol catabolism eda hi 2-dehydro-3-deoxy-phosphogluconate aldolase (EC 4.1.2.14) (characterized) 52% 100% 260
sucrose catabolism eda hi 2-dehydro-3-deoxy-phosphogluconate aldolase (EC 4.1.2.14) (characterized) 52% 100% 260
trehalose catabolism eda hi 2-dehydro-3-deoxy-phosphogluconate aldolase (EC 4.1.2.14) (characterized) 52% 100% 260
D-galactose catabolism dgoA lo 4-hydroxy-2-oxoglutarate aldolase (EC 4.1.3.16; EC 4.1.2.55) (characterized) 34% 91% 100.1 2-dehydro-3-deoxy-phosphogluconate aldolase (EC 4.1.2.14) 52% 260.0
D-glucosamine (chitosamine) catabolism kdgA lo 4-hydroxy-2-oxoglutarate aldolase (EC 4.1.3.16; EC 4.1.2.55) (characterized) 34% 91% 100.1 2-dehydro-3-deoxy-phosphogluconate aldolase (EC 4.1.2.14) 52% 260.0
lactose catabolism dgoA lo 4-hydroxy-2-oxoglutarate aldolase (EC 4.1.3.16; EC 4.1.2.55) (characterized) 34% 91% 100.1 2-dehydro-3-deoxy-phosphogluconate aldolase (EC 4.1.2.14) 52% 260.0

Sequence Analysis Tools

View 350017 at FitnessBrowser

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MAKFDKIAVLNKIGSTGMVPVFYHKDAEVAKKVVKACYDGGVRAFEFTNRGDFAQEVFAE
IVKYAAKECPEMAIGIGSIVDPATAAMYLQLGANFVVGPLFNPEIAKICNRRLVAYTPGC
GSVSEVGFAQEVGCDLCKVFPGDVYGTNFVKGLMAPMPWSKLMVTGGVEPSKENLTAWIK
AGVFCVGMGSKLFPKDKVAAEDWAYVTAKCEEALSYIAEARKK

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory