Protein 353166 in Bacteroides thetaiotaomicron VPI-5482
Annotation: FitnessBrowser__Btheta:353166
Length: 218 amino acids
Source: Btheta in FitnessBrowser
Candidate for 40 steps in catabolism of small carbon sources
Pathway | Step | Score | Similar to | Id. | Cov. | Bits | Other hit | Other id. | Other bits |
L-arginine catabolism | artP | med | Arginine transport ATP-binding protein ArtM (characterized) | 42% | 90% | 171.4 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 50% | 207.6 |
L-glutamate catabolism | gltL | lo | GluA aka CGL1950, component of Glutamate porter (characterized) | 40% | 90% | 153.3 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 50% | 207.6 |
L-asparagine catabolism | aatP | lo | ABC transporter for L-aspartate, L-asparagine, L-glutamate, and L-glutamine, ATPase component (characterized) | 37% | 89% | 150.2 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 50% | 207.6 |
L-aspartate catabolism | aatP | lo | ABC transporter for L-aspartate, L-asparagine, L-glutamate, and L-glutamine, ATPase component (characterized) | 37% | 89% | 150.2 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 50% | 207.6 |
putrescine catabolism | potA | lo | spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 (characterized) | 37% | 56% | 148.3 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 50% | 207.6 |
L-lysine catabolism | hisP | lo | Amino-acid ABC transporter, ATP-binding protein (characterized, see rationale) | 36% | 83% | 147.5 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 50% | 207.6 |
L-asparagine catabolism | peb1C | lo | PEB1C, component of Uptake system for glutamate and aspartate (characterized) | 37% | 90% | 147.1 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 50% | 207.6 |
L-aspartate catabolism | peb1C | lo | PEB1C, component of Uptake system for glutamate and aspartate (characterized) | 37% | 90% | 147.1 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 50% | 207.6 |
D-maltose catabolism | malK_Bb | lo | ABC-type maltose transport, ATP binding protein (characterized, see rationale) | 38% | 61% | 146 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 50% | 207.6 |
L-histidine catabolism | hisP | lo | histidine transport ATP-binding protein hisP (characterized) | 36% | 87% | 145.6 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 50% | 207.6 |
D-sorbitol (glucitol) catabolism | mtlK | lo | ABC transporter for D-Sorbitol, ATPase component (characterized) | 35% | 63% | 144.1 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 50% | 207.6 |
lactose catabolism | lacK | lo | ABC transporter for Lactose, ATPase component (characterized) | 39% | 59% | 142.1 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 50% | 207.6 |
L-fucose catabolism | SM_b21106 | lo | ABC transporter for L-Fucose, ATPase component (characterized) | 36% | 58% | 141 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 50% | 207.6 |
L-citrulline catabolism | PS417_17605 | lo | ATP-binding cassette domain-containing protein; SubName: Full=Amino acid transporter; SubName: Full=Histidine ABC transporter ATP-binding protein; SubName: Full=Histidine transport system ATP-binding protein (characterized, see rationale) | 35% | 82% | 139.4 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 50% | 207.6 |
L-histidine catabolism | bgtA | lo | BgtA aka SLR1735, component of Arginine/lysine/histidine/glutamine porter (characterized) | 34% | 87% | 137.5 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 50% | 207.6 |
D-maltose catabolism | thuK | lo | Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 (characterized) | 34% | 58% | 137.5 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 50% | 207.6 |
D-mannitol catabolism | mtlK | lo | ABC transporter for D-mannitol and D-mannose, ATPase component (characterized) | 33% | 57% | 136.3 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 50% | 207.6 |
L-histidine catabolism | hutV | lo | HutV aka HISV aka R02702 aka SMC00670, component of Uptake system for hisitidine, proline, proline-betaine and glycine-betaine (characterized) | 36% | 77% | 121.7 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 50% | 207.6 |
L-proline catabolism | hutV | lo | HutV aka HISV aka R02702 aka SMC00670, component of Uptake system for hisitidine, proline, proline-betaine and glycine-betaine (characterized) | 36% | 77% | 121.7 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 50% | 207.6 |
L-isoleucine catabolism | livG | lo | ABC transporter ATP-binding protein (characterized, see rationale) | 33% | 86% | 117.5 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 50% | 207.6 |
L-leucine catabolism | livG | lo | ABC transporter ATP-binding protein (characterized, see rationale) | 33% | 86% | 117.5 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 50% | 207.6 |
L-phenylalanine catabolism | livG | lo | ABC transporter ATP-binding protein (characterized, see rationale) | 33% | 86% | 117.5 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 50% | 207.6 |
L-proline catabolism | HSERO_RS00895 | lo | ABC transporter ATP-binding protein (characterized, see rationale) | 33% | 86% | 117.5 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 50% | 207.6 |
L-serine catabolism | Ac3H11_1693 | lo | ABC transporter ATP-binding protein (characterized, see rationale) | 33% | 86% | 117.5 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 50% | 207.6 |
L-tyrosine catabolism | Ac3H11_1693 | lo | ABC transporter ATP-binding protein (characterized, see rationale) | 33% | 86% | 117.5 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 50% | 207.6 |
D-alanine catabolism | AZOBR_RS08250 | lo | Leucine//isoleucine/valine ABC transporter,ATPase component; EC 3.6.3.- (characterized, see rationale) | 31% | 90% | 107.5 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 50% | 207.6 |
L-proline catabolism | AZOBR_RS08250 | lo | Leucine//isoleucine/valine ABC transporter,ATPase component; EC 3.6.3.- (characterized, see rationale) | 31% | 90% | 107.5 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 50% | 207.6 |
D-lactate catabolism | PGA1_c12640 | lo | D-lactate transporter, ATP-binding component (characterized) | 31% | 89% | 105.5 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 50% | 207.6 |
L-alanine catabolism | braF | lo | NatA aka BRAF aka SLR0467, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized) | 32% | 78% | 101.3 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 50% | 207.6 |
L-histidine catabolism | natA | lo | NatA aka BRAF aka SLR0467, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized) | 32% | 78% | 101.3 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 50% | 207.6 |
L-leucine catabolism | natA | lo | NatA aka BRAF aka SLR0467, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized) | 32% | 78% | 101.3 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 50% | 207.6 |
L-proline catabolism | natA | lo | NatA aka BRAF aka SLR0467, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized) | 32% | 78% | 101.3 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 50% | 207.6 |
L-serine catabolism | braF | lo | NatA aka BRAF aka SLR0467, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized) | 32% | 78% | 101.3 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 50% | 207.6 |
L-threonine catabolism | braF | lo | NatA aka BRAF aka SLR0467, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized) | 32% | 78% | 101.3 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 50% | 207.6 |
L-proline catabolism | HSERO_RS00900 | lo | ABC-type branched-chain amino acid transport system, ATPase component protein (characterized, see rationale) | 32% | 89% | 100.1 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 50% | 207.6 |
L-isoleucine catabolism | livF | lo | ABC transporter ATP-binding protein (characterized, see rationale) | 32% | 88% | 95.9 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 50% | 207.6 |
L-leucine catabolism | livF | lo | ABC transporter ATP-binding protein (characterized, see rationale) | 32% | 88% | 95.9 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 50% | 207.6 |
L-phenylalanine catabolism | livF | lo | ABC transporter ATP-binding protein (characterized, see rationale) | 32% | 88% | 95.9 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 50% | 207.6 |
L-serine catabolism | Ac3H11_1692 | lo | ABC transporter ATP-binding protein (characterized, see rationale) | 32% | 88% | 95.9 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 50% | 207.6 |
L-tyrosine catabolism | Ac3H11_1692 | lo | ABC transporter ATP-binding protein (characterized, see rationale) | 32% | 88% | 95.9 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 50% | 207.6 |
Sequence Analysis Tools
View 353166 at FitnessBrowser
Find papers: PaperBLAST
Find functional residues: SitesBLAST
Search for conserved domains
Find the best match in UniProt
Compare to protein structures
Predict transmenbrane helices: Phobius
Predict protein localization: PSORTb
Find homologs in fast.genomics
Fitness BLAST: loading...
Sequence
MIKLEGITKSFGSLQVLKGIDLEINKGEIVSIVGPSGAGKTTLLQIMGTLDEPDAGTVAI
DGTVVSRMKEKELSAFRNKNIGFVFQFHQLLPEFTALENVMIPAFIAGVSSKEANERAME
ILAFMGLTDRASHKPNELSGGEKQRVAVARALINHPAVILADEPSGSLDTHNKEDLHQLF
FDLRDRLGQTFVIVTHDEGLAKITDRTVHMVDGTIKKD
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Links
Downloads
Related tools
About GapMind
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using
ublast (a fast alternative to protein BLAST)
against a database of manually-curated proteins (most of which are experimentally characterized) or by using
HMMer with enzyme models (usually from
TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
- ublast finds a hit to a characterized protein at above 40% identity and 80% coverage, and bits >= other bits+10.
- (Hits to curated proteins without experimental data as to their function are never considered high confidence.)
- HMMer finds a hit with 80% coverage of the model, and either other identity < 40 or other coverage < 0.75.
where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").
Otherwise, a candidate is "medium confidence" if either:
- ublast finds a hit at above 40% identity and 70% coverage (ignoring otherBits).
- ublast finds a hit at above 30% identity and 80% coverage, and bits >= other bits.
- HMMer finds a hit (regardless of coverage or other bits).
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps."
For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways.
For diverse bacteria and archaea that can utilize a carbon source, there is a complete
high-confidence catabolic pathway (including a transporter) just 38% of the time, and
there is a complete medium-confidence pathway 63% of the time.
Gaps may be due to:
- our ignorance of proteins' functions,
- omissions in the gene models,
- frame-shift errors in the genome sequence, or
- the organism lacks the pathway.
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory