Annotation: FitnessBrowser__Caulo:CCNA_00092
Length: 296 amino acids
Source: Caulo in FitnessBrowser
| Pathway | Step | Score | Similar to | Id. | Cov. | Bits | Other hit | Other id. | Other bits |
|---|---|---|---|---|---|---|---|---|---|
| L-fucose catabolism | fucDH | med | Short-chain dehydrogenase/reductase SDR (characterized, see rationale) | 40% | 99% | 152.1 | momilactone-A synthase (EC 1.1.1.295) | 42% | 185.3 |
| D-xylose catabolism | DKDP-dehydrog | lo | SDR family oxidoreductase (characterized, see rationale) | 36% | 97% | 137.5 | momilactone-A synthase (EC 1.1.1.295) | 42% | 185.3 |
| L-arabinose catabolism | xacB | lo | L-arabinose 1-dehydrogenase (EC 1.1.1.46) (characterized) | 33% | 96% | 129.8 | momilactone-A synthase (EC 1.1.1.295) | 42% | 185.3 |
| D-xylose catabolism | xdh | lo | D-xylose 1-dehydrogenase (EC 1.1.1.175) (characterized) | 34% | 93% | 120.6 | momilactone-A synthase (EC 1.1.1.295) | 42% | 185.3 |
| L-isoleucine catabolism | ivdG | lo | GDP-6-deoxy-D-talose 4-dehydrogenase (EC 1.1.1.135); 3-hydroxy-2-methylbutyryl-CoA dehydrogenase (EC 1.1.1.178) (characterized) | 32% | 97% | 117.1 | momilactone-A synthase (EC 1.1.1.295) | 42% | 185.3 |
View CCNA_00092 at FitnessBrowser
Find papers: PaperBLAST
Find functional residues: SitesBLAST
Search for conserved domains
Find the best match in UniProt
Compare to protein structures
Predict transmenbrane helices: Phobius
Predict protein localization: PSORTb
Find homologs in fast.genomics
Fitness BLAST: loading...
MVGRLNGKVAVITGGCSGIGLGTVELFVAEGACVVAADLQDEKGRMLEQRFPDQVRFARC DVTADDDLAKTMALAESSFGGLDILFNNAGHGGTPASVPELTAEAWDKTFALLVRGPAMG MTHALPLMQKRGGGSIINTASIAGLQAGFGPLAYSSAKAAVIHMSRCAAAELSPQKIRVN AICPGLIATSIFGASMGLPREVADQMAAQIASIGPKIQPIPKSGLPEDIAAAALYLASDD SRFVTGTHIVVDGGITVGPRSAWDINTPSPILAAMGITPEQAEQMRAQLLAAGGTG
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory