GapMind for catabolism of small carbon sources

 

Protein CCNA_03235 in Caulobacter crescentus NA1000

Annotation: CCNA_03235 spermidine/putrescine transport ATP-binding protein potA

Length: 381 amino acids

Source: Caulo in FitnessBrowser

Candidate for 99 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
putrescine catabolism potA hi PotG aka B0855, component of Putrescine porter (characterized) 49% 95% 342.8 CP4-6 prophage; ABC transporter ATP-binding protein AfuC 46% 282.3
D-cellobiose catabolism gtsD med Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 44% 86% 263.1 PotG aka B0855, component of Putrescine porter 49% 342.8
D-glucose catabolism gtsD med Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 44% 86% 263.1 PotG aka B0855, component of Putrescine porter 49% 342.8
lactose catabolism gtsD med Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 44% 86% 263.1 PotG aka B0855, component of Putrescine porter 49% 342.8
D-maltose catabolism gtsD med Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 44% 86% 263.1 PotG aka B0855, component of Putrescine porter 49% 342.8
D-maltose catabolism thuK med Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 44% 86% 263.1 PotG aka B0855, component of Putrescine porter 49% 342.8
D-mannose catabolism TT_C0211 med Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 44% 86% 263.1 PotG aka B0855, component of Putrescine porter 49% 342.8
sucrose catabolism gtsD med Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 44% 86% 263.1 PotG aka B0855, component of Putrescine porter 49% 342.8
sucrose catabolism thuK med Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 44% 86% 263.1 PotG aka B0855, component of Putrescine porter 49% 342.8
trehalose catabolism gtsD med Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 44% 86% 263.1 PotG aka B0855, component of Putrescine porter 49% 342.8
trehalose catabolism thuK med Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 44% 86% 263.1 PotG aka B0855, component of Putrescine porter 49% 342.8
L-arabinose catabolism xacJ med Xylose/arabinose import ATP-binding protein XacJ; EC 7.5.2.13 (characterized, see rationale) 49% 75% 253.8 PotG aka B0855, component of Putrescine porter 49% 342.8
xylitol catabolism Dshi_0546 med ABC transporter for Xylitol, ATPase component (characterized) 41% 94% 252.3 PotG aka B0855, component of Putrescine porter 49% 342.8
lactose catabolism lacK med ABC transporter for Lactose, ATPase component (characterized) 41% 91% 251.1 PotG aka B0855, component of Putrescine porter 49% 342.8
D-cellobiose catabolism msiK med MsiK protein, component of The cellobiose/cellotriose (and possibly higher cellooligosaccharides), CebEFGMsiK [MsiK functions to energize several ABC transporters including those for maltose/maltotriose and trehalose] (characterized) 42% 93% 250 PotG aka B0855, component of Putrescine porter 49% 342.8
D-maltose catabolism malK med Maltose-transporting ATPase (EC 3.6.3.19) (characterized) 45% 79% 248.1 PotG aka B0855, component of Putrescine porter 49% 342.8
D-maltose catabolism malK1 med MalK; aka Sugar ABC transporter, ATP-binding protein, component of The maltose, maltotriose, mannotetraose (MalE1)/maltose, maltotriose, trehalose (MalE2) porter (Nanavati et al., 2005). For MalG1 (823aas) and MalG2 (833aas), the C-terminal transmembrane domain with 6 putative TMSs is preceded by a single N-terminal TMS and a large (600 residue) hydrophilic region showing sequence similarity to MLP1 and 2 (9.A.14; e-12 & e-7) as well as other proteins (characterized) 42% 88% 248.1 PotG aka B0855, component of Putrescine porter 49% 342.8
D-mannitol catabolism mtlK med SmoK aka POLK, component of Hexitol (glucitol; mannitol) porter (characterized) 40% 94% 243.8 PotG aka B0855, component of Putrescine porter 49% 342.8
L-arabinose catabolism xacK med Xylose/arabinose import ATP-binding protein XacK; EC 7.5.2.13 (characterized, see rationale) 45% 76% 241.1 PotG aka B0855, component of Putrescine porter 49% 342.8
D-maltose catabolism malK_Bb med ABC-type maltose transport, ATP binding protein (characterized, see rationale) 50% 71% 238.4 PotG aka B0855, component of Putrescine porter 49% 342.8
D-maltose catabolism musK med ABC-type maltose transporter (EC 7.5.2.1) (characterized) 42% 87% 237.3 PotG aka B0855, component of Putrescine porter 49% 342.8
D-sorbitol (glucitol) catabolism mtlK med ABC transporter for D-Sorbitol, ATPase component (characterized) 40% 93% 237.3 PotG aka B0855, component of Putrescine porter 49% 342.8
D-xylose catabolism gtsD med ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) 42% 78% 236.1 PotG aka B0855, component of Putrescine porter 49% 342.8
D-galactose catabolism PfGW456L13_1897 med ABC transporter for D-Galactose and D-Glucose, ATPase component (characterized) 44% 77% 234.2 PotG aka B0855, component of Putrescine porter 49% 342.8
D-maltose catabolism malK_Aa med ABC-type maltose transporter (EC 7.5.2.1) (characterized) 44% 76% 233.8 PotG aka B0855, component of Putrescine porter 49% 342.8
D-cellobiose catabolism SMc04256 med ABC transporter for D-Cellobiose and D-Salicin, ATPase component (characterized) 41% 92% 232.6 PotG aka B0855, component of Putrescine porter 49% 342.8
N-acetyl-D-glucosamine catabolism SMc02869 med N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 49% 70% 230.7 PotG aka B0855, component of Putrescine porter 49% 342.8
D-glucosamine (chitosamine) catabolism SMc02869 med N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 49% 70% 230.7 PotG aka B0855, component of Putrescine porter 49% 342.8
D-maltose catabolism aglK med ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 43% 81% 230.3 PotG aka B0855, component of Putrescine porter 49% 342.8
sucrose catabolism aglK med ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 43% 81% 230.3 PotG aka B0855, component of Putrescine porter 49% 342.8
trehalose catabolism aglK med ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 43% 81% 230.3 PotG aka B0855, component of Putrescine porter 49% 342.8
D-glucosamine (chitosamine) catabolism SM_b21216 med ABC transporter for D-Glucosamine, ATPase component (characterized) 41% 79% 228.8 PotG aka B0855, component of Putrescine porter 49% 342.8
trehalose catabolism treV med TreV, component of Trehalose porter (characterized) 47% 75% 226.1 PotG aka B0855, component of Putrescine porter 49% 342.8
D-maltose catabolism malK_Sm med MalK, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized) 42% 83% 225.3 PotG aka B0855, component of Putrescine porter 49% 342.8
trehalose catabolism malK med MalK, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized) 42% 83% 225.3 PotG aka B0855, component of Putrescine porter 49% 342.8
L-arabinose catabolism araV med AraV, component of Arabinose, fructose, xylose porter (characterized) 43% 72% 215.7 PotG aka B0855, component of Putrescine porter 49% 342.8
D-fructose catabolism araV med AraV, component of Arabinose, fructose, xylose porter (characterized) 43% 72% 215.7 PotG aka B0855, component of Putrescine porter 49% 342.8
sucrose catabolism araV med AraV, component of Arabinose, fructose, xylose porter (characterized) 43% 72% 215.7 PotG aka B0855, component of Putrescine porter 49% 342.8
D-xylose catabolism araV med AraV, component of Arabinose, fructose, xylose porter (characterized) 43% 72% 215.7 PotG aka B0855, component of Putrescine porter 49% 342.8
L-proline catabolism opuBA med BilEA aka OpuBA protein, component of A proline/glycine betaine uptake system. Also reported to be a bile exclusion system that exports oxgall and other bile compounds, BilEA/EB or OpuBA/BB (required for normal virulence) (characterized) 41% 75% 183 PotG aka B0855, component of Putrescine porter 49% 342.8
L-histidine catabolism Ac3H11_2560 med ABC transporter for L-Histidine, ATPase component (characterized) 43% 77% 158.3 PotG aka B0855, component of Putrescine porter 49% 342.8
L-fucose catabolism SM_b21106 lo ABC transporter for L-Fucose, ATPase component (characterized) 50% 67% 241.1 PotG aka B0855, component of Putrescine porter 49% 342.8
D-cellobiose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 40% 86% 220.7 PotG aka B0855, component of Putrescine porter 49% 342.8
D-glucose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 40% 86% 220.7 PotG aka B0855, component of Putrescine porter 49% 342.8
lactose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 40% 86% 220.7 PotG aka B0855, component of Putrescine porter 49% 342.8
D-maltose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 40% 86% 220.7 PotG aka B0855, component of Putrescine porter 49% 342.8
sucrose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 40% 86% 220.7 PotG aka B0855, component of Putrescine porter 49% 342.8
trehalose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 40% 86% 220.7 PotG aka B0855, component of Putrescine porter 49% 342.8
D-cellobiose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 39% 87% 216.9 PotG aka B0855, component of Putrescine porter 49% 342.8
D-galactose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 39% 87% 216.9 PotG aka B0855, component of Putrescine porter 49% 342.8
D-glucose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 39% 87% 216.9 PotG aka B0855, component of Putrescine porter 49% 342.8
lactose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 39% 87% 216.9 PotG aka B0855, component of Putrescine porter 49% 342.8
D-maltose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 39% 87% 216.9 PotG aka B0855, component of Putrescine porter 49% 342.8
D-mannose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 39% 87% 216.9 PotG aka B0855, component of Putrescine porter 49% 342.8
sucrose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 39% 87% 216.9 PotG aka B0855, component of Putrescine porter 49% 342.8
trehalose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 39% 87% 216.9 PotG aka B0855, component of Putrescine porter 49% 342.8
xylitol catabolism HSERO_RS17020 lo ABC-type sugar transport system, ATPase component protein (characterized, see rationale) 47% 55% 208.4 PotG aka B0855, component of Putrescine porter 49% 342.8
L-proline catabolism proV lo glycine betaine/l-proline transport atp-binding protein prov (characterized) 38% 66% 186.8 PotG aka B0855, component of Putrescine porter 49% 342.8
glycerol catabolism glpT lo GlpT, component of Glycerol uptake porter, GlpSTPQV (characterized) 38% 68% 175.6 PotG aka B0855, component of Putrescine porter 49% 342.8
L-histidine catabolism hutV lo ABC transporter for L-Histidine, ATPase component (characterized) 39% 86% 171 PotG aka B0855, component of Putrescine porter 49% 342.8
L-proline catabolism hutV lo HutV aka HISV aka R02702 aka SMC00670, component of Uptake system for hisitidine, proline, proline-betaine and glycine-betaine (characterized) 38% 89% 167.5 PotG aka B0855, component of Putrescine porter 49% 342.8
D-alanine catabolism Pf6N2E2_5405 lo ABC transporter for D-Alanine, ATPase component (characterized) 36% 99% 163.3 PotG aka B0855, component of Putrescine porter 49% 342.8
glycerol catabolism glpS lo ABC transporter for Glycerol, ATPase component 1 (characterized) 33% 83% 161.4 PotG aka B0855, component of Putrescine porter 49% 342.8
L-asparagine catabolism bztD lo BztD, component of Glutamate/glutamine/aspartate/asparagine porter (characterized) 35% 90% 157.9 PotG aka B0855, component of Putrescine porter 49% 342.8
L-aspartate catabolism bztD lo BztD, component of Glutamate/glutamine/aspartate/asparagine porter (characterized) 35% 90% 157.9 PotG aka B0855, component of Putrescine porter 49% 342.8
L-glutamate catabolism gltL lo BztD, component of Glutamate/glutamine/aspartate/asparagine porter (characterized) 35% 90% 157.9 PotG aka B0855, component of Putrescine porter 49% 342.8
L-histidine catabolism bgtA lo BgtA aka SLR1735, component of Arginine/lysine/histidine/glutamine porter (characterized) 36% 99% 157.1 PotG aka B0855, component of Putrescine porter 49% 342.8
L-lysine catabolism hisP lo BgtA aka SLR1735, component of Arginine/lysine/histidine/glutamine porter (characterized) 36% 99% 157.1 PotG aka B0855, component of Putrescine porter 49% 342.8
L-asparagine catabolism bgtA lo ATPase (characterized, see rationale) 37% 94% 155.6 PotG aka B0855, component of Putrescine porter 49% 342.8
L-aspartate catabolism bgtA lo ATPase (characterized, see rationale) 37% 94% 155.6 PotG aka B0855, component of Putrescine porter 49% 342.8
L-histidine catabolism aapP lo ABC transporter for L-Glutamine, L-Histidine, and other L-amino acids, ATPase component (characterized) 34% 95% 152.5 PotG aka B0855, component of Putrescine porter 49% 342.8
L-asparagine catabolism glnQ lo Glutamine ABC transporter ATP-binding protein, component of Glutamine transporter, GlnQP. Takes up glutamine, asparagine and glutamate which compete for each other for binding both substrate and the transmembrane protein constituent of the system (Fulyani et al. 2015). Tandem substrate binding domains (SBDs) differ in substrate specificity and affinity, allowing cells to efficiently accumulate different amino acids via a single ABC transporter. Analysis revealed the roles of individual residues in determining the substrate affinity (characterized) 36% 96% 151.4 PotG aka B0855, component of Putrescine porter 49% 342.8
L-asparagine catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 32% 95% 143.7 PotG aka B0855, component of Putrescine porter 49% 342.8
L-aspartate catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 32% 95% 143.7 PotG aka B0855, component of Putrescine porter 49% 342.8
L-glutamate catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 32% 95% 143.7 PotG aka B0855, component of Putrescine porter 49% 342.8
L-leucine catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 32% 95% 143.7 PotG aka B0855, component of Putrescine porter 49% 342.8
L-proline catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 32% 95% 143.7 PotG aka B0855, component of Putrescine porter 49% 342.8
L-isoleucine catabolism livG lo High-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG (characterized, see rationale) 33% 99% 138.7 PotG aka B0855, component of Putrescine porter 49% 342.8
L-phenylalanine catabolism livG lo High-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG (characterized, see rationale) 33% 99% 138.7 PotG aka B0855, component of Putrescine porter 49% 342.8
L-asparagine catabolism aatP lo PP1068, component of Acidic amino acid uptake porter, AatJMQP (characterized) 35% 90% 137.5 PotG aka B0855, component of Putrescine porter 49% 342.8
L-aspartate catabolism aatP lo PP1068, component of Acidic amino acid uptake porter, AatJMQP (characterized) 35% 90% 137.5 PotG aka B0855, component of Putrescine porter 49% 342.8
L-alanine catabolism braF lo High-affinity branched-chain amino acid transport ATP-binding protein BraF, component of Branched chain amino acid uptake transporter. Transports alanine (characterized) 31% 99% 133.7 PotG aka B0855, component of Putrescine porter 49% 342.8
L-leucine catabolism livG lo High-affinity branched-chain amino acid transport ATP-binding protein BraF, component of Branched chain amino acid uptake transporter. Transports alanine (characterized) 31% 99% 133.7 PotG aka B0855, component of Putrescine porter 49% 342.8
L-serine catabolism braF lo High-affinity branched-chain amino acid transport ATP-binding protein BraF, component of Branched chain amino acid uptake transporter. Transports alanine (characterized) 31% 99% 133.7 PotG aka B0855, component of Putrescine porter 49% 342.8
L-threonine catabolism braF lo High-affinity branched-chain amino acid transport ATP-binding protein BraF, component of Branched chain amino acid uptake transporter. Transports alanine (characterized) 31% 99% 133.7 PotG aka B0855, component of Putrescine porter 49% 342.8
L-valine catabolism livG lo High-affinity branched-chain amino acid transport ATP-binding protein BraF, component of Branched chain amino acid uptake transporter. Transports alanine (characterized) 31% 99% 133.7 PotG aka B0855, component of Putrescine porter 49% 342.8
D-mannose catabolism TM1750 lo TM1750, component of Probable mannose/mannoside porter. Induced by beta-mannan (Conners et al., 2005). Regulated by mannose-responsive regulator manR (characterized) 33% 73% 129 PotG aka B0855, component of Putrescine porter 49% 342.8
L-tryptophan catabolism ecfA1 lo Energy-coupling factor transporter ATP-binding protein EcfA1; Short=ECF transporter A component EcfA; EC 7.-.-.- (characterized, see rationale) 36% 91% 129 PotG aka B0855, component of Putrescine porter 49% 342.8
myo-inositol catabolism PGA1_c07320 lo Inositol transport system ATP-binding protein (characterized) 33% 90% 118.6 PotG aka B0855, component of Putrescine porter 49% 342.8
D-cellobiose catabolism cbtF lo CbtF, component of Cellobiose and cellooligosaccharide porter (characterized) 33% 77% 118.2 PotG aka B0855, component of Putrescine porter 49% 342.8
L-isoleucine catabolism livF lo high-affinity branched-chain amino acid ABC transporter, ATP-binding protein LivF (characterized) 36% 89% 115.5 PotG aka B0855, component of Putrescine porter 49% 342.8
L-leucine catabolism livF lo high-affinity branched-chain amino acid ABC transporter, ATP-binding protein LivF (characterized) 36% 89% 115.5 PotG aka B0855, component of Putrescine porter 49% 342.8
L-phenylalanine catabolism livF lo high-affinity branched-chain amino acid ABC transporter, ATP-binding protein LivF (characterized) 36% 89% 115.5 PotG aka B0855, component of Putrescine porter 49% 342.8
L-valine catabolism livF lo high-affinity branched-chain amino acid ABC transporter, ATP-binding protein LivF (characterized) 36% 89% 115.5 PotG aka B0855, component of Putrescine porter 49% 342.8
L-alanine catabolism braG lo High-affinity branched-chain amino acid transport ATP-binding protein BraG, component of Branched chain amino acid uptake transporter. Transports alanine (characterized) 30% 97% 110.2 PotG aka B0855, component of Putrescine porter 49% 342.8
L-serine catabolism braG lo High-affinity branched-chain amino acid transport ATP-binding protein BraG, component of Branched chain amino acid uptake transporter. Transports alanine (characterized) 30% 97% 110.2 PotG aka B0855, component of Putrescine porter 49% 342.8
L-threonine catabolism braG lo High-affinity branched-chain amino acid transport ATP-binding protein BraG, component of Branched chain amino acid uptake transporter. Transports alanine (characterized) 30% 97% 110.2 PotG aka B0855, component of Putrescine porter 49% 342.8
D-alanine catabolism AZOBR_RS08245 lo Leucine/isoleucine/valine ABC transporter,ATPase component; EC 3.6.3.- (characterized, see rationale) 31% 82% 109 PotG aka B0855, component of Putrescine porter 49% 342.8
L-proline catabolism AZOBR_RS08245 lo Leucine/isoleucine/valine ABC transporter,ATPase component; EC 3.6.3.- (characterized, see rationale) 31% 82% 109 PotG aka B0855, component of Putrescine porter 49% 342.8

Sequence Analysis Tools

View CCNA_03235 at FitnessBrowser

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Predict protein localization: PSORTb (Gram negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the SEED with FIGfam search

Fitness BLAST: loading...

Sequence

MCRGISAMTTPKPIITFENVTKRFGKLAAVDNVSLTVNEGEFFALLGPSGCGKTTLLRML
AGFETPTEGRILIDGQDISNVPPNKRPVNMVFQSYAVFPHMTVADNVAYGLKVDNVPKAE
REARVAEALELVQLGGLGGRKPDQLSGGQRQRVALARALVKRPRVLLLDEPLSALDAKLR
EQMRTELCTLQEKVGITFIMVTHDQDEALALASRCAVMSKGLLQQVATPSDLYEFPNSRF
VADFIGQVNLFEGVLAVDEPSHAVIKSPDLPVDIFLDHGVTGPRGGTVWAAIRPEKIELH
KKADDTPPNLGDAPKGTNAVEGVIKHEAYLGGSSTYEVEIAGGRRVKVQRSNLTRWDQED
FKLGETVWLCWHACSPAVLLS

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory