GapMind for catabolism of small carbon sources

 

Protein N515DRAFT_1821 in Dyella japonica UNC79MFTsu3.2

Annotation: N515DRAFT_1821 putative ABC transport system ATP-binding protein

Length: 238 amino acids

Source: Dyella79 in FitnessBrowser

Candidate for 23 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
L-glutamate catabolism gltL med GluA aka CGL1950, component of Glutamate porter (characterized) 42% 92% 169.5 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 46% 208.8
L-asparagine catabolism bgtA med ATPase (characterized, see rationale) 40% 86% 154.1 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 46% 208.8
L-aspartate catabolism bgtA med ATPase (characterized, see rationale) 40% 86% 154.1 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 46% 208.8
L-asparagine catabolism bztD lo BztD, component of Glutamate/glutamine/aspartate/asparagine porter (characterized) 37% 87% 154.8 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 46% 208.8
L-aspartate catabolism bztD lo BztD, component of Glutamate/glutamine/aspartate/asparagine porter (characterized) 37% 87% 154.8 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 46% 208.8
L-histidine catabolism PA5503 lo Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN (characterized) 39% 70% 154.8 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 46% 208.8
L-lysine catabolism hisP lo Amino-acid ABC transporter, ATP-binding protein (characterized, see rationale) 37% 90% 153.3 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 46% 208.8
L-asparagine catabolism aatP lo PP1068, component of Acidic amino acid uptake porter, AatJMQP (characterized) 37% 90% 152.1 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 46% 208.8
L-aspartate catabolism aatP lo PP1068, component of Acidic amino acid uptake porter, AatJMQP (characterized) 37% 90% 152.1 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 46% 208.8
L-arginine catabolism artP lo Arginine transport ATP-binding protein ArtM (characterized) 38% 93% 146.4 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 46% 208.8
putrescine catabolism potA lo Spermidine/putrescine import ATP-binding protein PotA, component of The spermidine/putrescine uptake porter, PotABCD (characterized) 39% 59% 146.4 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 46% 208.8
L-proline catabolism proV lo Glycine betaine/proline betaine transport system ATP-binding protein ProV (characterized) 36% 52% 136 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 46% 208.8
trehalose catabolism malK lo MsmK aka SMU.882, component of The raffinose/stachyose transporter, MsmEFGK (MalK (3.A.1.1.27) can probably substitute for MsmK; Webb et al., 2008). This system may also transport melibiose, isomaltotriose and sucrose as well as isomaltosaccharides (characterized) 38% 54% 136 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 46% 208.8
xylitol catabolism Dshi_0546 lo ABC transporter for Xylitol, ATPase component (characterized) 35% 70% 135.6 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 46% 208.8
D-maltose catabolism malK1 lo MalK; aka Sugar ABC transporter, ATP-binding protein, component of The maltose, maltotriose, mannotetraose (MalE1)/maltose, maltotriose, trehalose (MalE2) porter (Nanavati et al., 2005). For MalG1 (823aas) and MalG2 (833aas), the C-terminal transmembrane domain with 6 putative TMSs is preceded by a single N-terminal TMS and a large (600 residue) hydrophilic region showing sequence similarity to MLP1 and 2 (9.A.14; e-12 & e-7) as well as other proteins (characterized) 34% 61% 134 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 46% 208.8
N-acetyl-D-glucosamine catabolism SMc02869 lo N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 36% 64% 132.1 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 46% 208.8
D-glucosamine (chitosamine) catabolism SMc02869 lo N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 36% 64% 132.1 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 46% 208.8
D-maltose catabolism malK_Sm lo MalK, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized) 37% 54% 130.6 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 46% 208.8
D-mannose catabolism TT_C0211 lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 37% 56% 122.5 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 46% 208.8
D-maltose catabolism aglK lo ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 33% 61% 121.7 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 46% 208.8
sucrose catabolism aglK lo ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 33% 61% 121.7 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 46% 208.8
trehalose catabolism aglK lo ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 33% 61% 121.7 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 46% 208.8
D-cellobiose catabolism TM0028 lo TM0028, component of β-glucoside porter (Conners et al., 2005). Binds cellobiose, laminaribiose (Nanavati et al. 2006). Regulated by cellobiose-responsive repressor BglR (characterized) 32% 72% 94.7 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 46% 208.8

Sequence Analysis Tools

View N515DRAFT_1821 at FitnessBrowser

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search PFam (including for weak hits, up to E = 1)

Predict protein localization: PSORTb (Gram negative bacteria)

Predict transmembrane helices: TMHMM

Check the SEED with FIGfam search

Fitness BLAST: loading...

Sequence

MLKMTHLSKVYRTEVVETYALRDFNIDVKEGEFVAVTGPSGSGKTTFLTIAGLLETFTGG
EYHLDGVEVSNLNDNARSKIRNEKIGFIFQAFNLIPDLNVYDNVEVPLRYRGMKALERKQ
RIMDALERVGLASRAKHYPAELSGGQQQRVAIARALAGSPRLLLADEPTGNLDTQMARGV
MELLEEIHREGATIVMVTHDPELATRAQRNVHVIDGQVVDLAEDPRFHQQQARAGAPA

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory