GapMind for catabolism of small carbon sources

 

Protein GFF1748 in Marinobacter adhaerens HP15

Annotation: HP15_1707 short-chain dehydrogenase/reductase SDR

Length: 256 amino acids

Source: Marino in FitnessBrowser

Candidate for 13 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
xylitol catabolism xdhA lo D-xylulose reductase (EC 1.1.1.9) (characterized) 35% 99% 150.2 cyclohexanol dehydrogenase (EC 1.1.1.245) 43% 198.0
D-xylose catabolism xdhA lo D-xylulose reductase (EC 1.1.1.9) (characterized) 35% 99% 150.2 cyclohexanol dehydrogenase (EC 1.1.1.245) 43% 198.0
L-arabinose catabolism xacB lo L-arabinose 1-dehydrogenase (EC 1.1.1.46) (characterized) 34% 92% 145.6 cyclohexanol dehydrogenase (EC 1.1.1.245) 43% 198.0
D-sorbitol (glucitol) catabolism sdh lo L-iditol 2-dehydrogenase (EC 1.1.1.14) (characterized) 37% 94% 145.6 cyclohexanol dehydrogenase (EC 1.1.1.245) 43% 198.0
D-mannitol catabolism mt2d lo Probable NADP-dependent mannitol dehydrogenase; MtDH; Mannitol 2-dehydrogenase [NADP(+)]; Short chain dehydrogenase/reductase; YlSDR; EC 1.1.1.138 (characterized) 35% 88% 144.1 cyclohexanol dehydrogenase (EC 1.1.1.245) 43% 198.0
L-fucose catabolism fucDH lo Short-chain dehydrogenase/reductase SDR (characterized, see rationale) 39% 99% 142.9 cyclohexanol dehydrogenase (EC 1.1.1.245) 43% 198.0
L-rhamnose catabolism LRA1 lo L-rhamnose-1-dehydrogenase; EC 1.1.1.173 (characterized) 37% 96% 141.7 cyclohexanol dehydrogenase (EC 1.1.1.245) 43% 198.0
D-galactose catabolism galdh lo L-arabinose 1-dehydrogenase / D-galactose 1-dehydrogenase (EC 1.1.1.46; EC 1.1.1.48) (characterized) 34% 92% 138.7 cyclohexanol dehydrogenase (EC 1.1.1.245) 43% 198.0
lactose catabolism galdh lo L-arabinose 1-dehydrogenase / D-galactose 1-dehydrogenase (EC 1.1.1.46; EC 1.1.1.48) (characterized) 34% 92% 138.7 cyclohexanol dehydrogenase (EC 1.1.1.245) 43% 198.0
glycerol catabolism dhaD lo NAD-dependent glycerol dehydrogenase; Dha-forming NAD-dependent glycerol dehydrogenase; EC 1.1.1.6 (characterized) 33% 96% 133.7 cyclohexanol dehydrogenase (EC 1.1.1.245) 43% 198.0
L-isoleucine catabolism ivdG lo GDP-6-deoxy-D-talose 4-dehydrogenase (EC 1.1.1.135); 3-hydroxy-2-methylbutyryl-CoA dehydrogenase (EC 1.1.1.178) (characterized) 34% 95% 105.5 cyclohexanol dehydrogenase (EC 1.1.1.245) 43% 198.0
2-deoxy-D-ribonate catabolism deoxyribonate-dehyd lo 2-deoxy-D-ribonate 3-dehydrogenase (characterized) 31% 94% 103.6 cyclohexanol dehydrogenase (EC 1.1.1.245) 43% 198.0
2-deoxy-D-ribose catabolism deoxyribonate-dehyd lo 2-deoxy-D-ribonate 3-dehydrogenase (characterized) 31% 94% 103.6 cyclohexanol dehydrogenase (EC 1.1.1.245) 43% 198.0

Sequence Analysis Tools

View GFF1748 at FitnessBrowser

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search PFam (including for weak hits, up to E = 1)

Predict protein localization: PSORTb (Gram negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the SEED with FIGfam search

Fitness BLAST: loading...

Sequence

MERLKGKVAVITGGSVGIGAATALRMAEEGAAVAILDCQDSEGEALAKQLEGRGLKAGYW
HCDVSKEQEVKQVLDAVANTFGTPTVLVNNAGIAGANKPTHELTEEEWDHVQDVNVKGVF
FCTKHAIPHMKKAGVGSIINLSSIYGLVSAPDIPPYHASKGAVRLMSKTDALLYATENIR
CNSIHPGFIWTPLVEAHLKTTGQDPEEAKKATAAMHPVGHMGEPDDIAWGAVYLASDESK
FVTGSELVIDGGYTAR

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory