GapMind for catabolism of small carbon sources

 

Protein 5210422 in Shewanella loihica PV-4

Annotation: FitnessBrowser__PV4:5210422

Length: 248 amino acids

Source: PV4 in FitnessBrowser

Candidate for 11 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
L-arabinose catabolism xacB lo L-arabinose 1-dehydrogenase / D-galactose 1-dehydrogenase (EC 1.1.1.46; EC 1.1.1.48) (characterized) 35% 93% 145.2 4-formylbenzenesulfonate dehydrogenase TsaC1/TsaC2; Toluenesulfonate zinc-independent alcohol dehydrogenase TsaC; EC 1.2.1.62 36% 163.7
D-galactose catabolism galdh lo L-arabinose 1-dehydrogenase / D-galactose 1-dehydrogenase (EC 1.1.1.46; EC 1.1.1.48) (characterized) 35% 93% 145.2 4-formylbenzenesulfonate dehydrogenase TsaC1/TsaC2; Toluenesulfonate zinc-independent alcohol dehydrogenase TsaC; EC 1.2.1.62 36% 163.7
lactose catabolism galdh lo L-arabinose 1-dehydrogenase / D-galactose 1-dehydrogenase (EC 1.1.1.46; EC 1.1.1.48) (characterized) 35% 93% 145.2 4-formylbenzenesulfonate dehydrogenase TsaC1/TsaC2; Toluenesulfonate zinc-independent alcohol dehydrogenase TsaC; EC 1.2.1.62 36% 163.7
xylitol catabolism xdhA lo D-xylulose reductase (EC 1.1.1.9) (characterized) 33% 100% 138.3 4-formylbenzenesulfonate dehydrogenase TsaC1/TsaC2; Toluenesulfonate zinc-independent alcohol dehydrogenase TsaC; EC 1.2.1.62 36% 163.7
D-xylose catabolism xdhA lo D-xylulose reductase (EC 1.1.1.9) (characterized) 33% 100% 138.3 4-formylbenzenesulfonate dehydrogenase TsaC1/TsaC2; Toluenesulfonate zinc-independent alcohol dehydrogenase TsaC; EC 1.2.1.62 36% 163.7
D-sorbitol (glucitol) catabolism sdh lo sorbitol dehydrogenase, D-fructose forming (EC 1.1.1.14) (characterized) 34% 98% 134 4-formylbenzenesulfonate dehydrogenase TsaC1/TsaC2; Toluenesulfonate zinc-independent alcohol dehydrogenase TsaC; EC 1.2.1.62 36% 163.7
L-fucose catabolism fucDH lo Short-chain alcohol dehydrogenase protein (characterized, see rationale) 35% 96% 125.6 4-formylbenzenesulfonate dehydrogenase TsaC1/TsaC2; Toluenesulfonate zinc-independent alcohol dehydrogenase TsaC; EC 1.2.1.62 36% 163.7
L-isoleucine catabolism ivdG lo 3-hydroxyacyl-CoA dehydrogenase type-2; 17-beta-hydroxysteroid dehydrogenase 10; 17-beta-HSD 10; 3-hydroxy-2-methylbutyryl-CoA dehydrogenase; 3-hydroxyacyl-CoA dehydrogenase type II; Mitochondrial ribonuclease P protein 2; Mitochondrial RNase P protein 2; Scully protein; Type II HADH; EC 1.1.1.35; EC 1.1.1.51; EC 1.1.1.178 (characterized) 34% 98% 124.8 4-formylbenzenesulfonate dehydrogenase TsaC1/TsaC2; Toluenesulfonate zinc-independent alcohol dehydrogenase TsaC; EC 1.2.1.62 36% 163.7
D-xylose catabolism DKDP-dehydrog lo SDR family oxidoreductase (characterized, see rationale) 33% 96% 123.6 4-formylbenzenesulfonate dehydrogenase TsaC1/TsaC2; Toluenesulfonate zinc-independent alcohol dehydrogenase TsaC; EC 1.2.1.62 36% 163.7
2-deoxy-D-ribonate catabolism deoxyribonate-dehyd lo 2-deoxy-D-ribonate dehydrogenase (characterized) 31% 97% 121.7 4-formylbenzenesulfonate dehydrogenase TsaC1/TsaC2; Toluenesulfonate zinc-independent alcohol dehydrogenase TsaC; EC 1.2.1.62 36% 163.7
2-deoxy-D-ribose catabolism deoxyribonate-dehyd lo 2-deoxy-D-ribonate dehydrogenase (characterized) 31% 97% 121.7 4-formylbenzenesulfonate dehydrogenase TsaC1/TsaC2; Toluenesulfonate zinc-independent alcohol dehydrogenase TsaC; EC 1.2.1.62 36% 163.7

Sequence Analysis Tools

View 5210422 at FitnessBrowser

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MQSNFEGKVVLITGAASGFGKLLAQRLAPQGAKLVLGDINDTALDALCSELGECAVGLRC
DVSIEAEQLALAQLAEESFGRLDIAINNAGISAPMKSLLATTEADMDLSFAINTKGVFFG
MKAQIPLMQKHKCGAILNVASMAGINGAPKLTPYVAAKHAVVGITRTAALEFAAQGIQVN
AICPFFTPTPMVTEGVDPALIEQLTRAVPMRRLADPNEVVSAMLHMVNPDNGFMTGQAIA
IDGGVSAI

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory