Protein 6937298 in Shewanella amazonensis SB2B
Annotation: FitnessBrowser__SB2B:6937298
Length: 230 amino acids
Source: SB2B in FitnessBrowser
Candidate for 33 steps in catabolism of small carbon sources
Pathway | Step | Score | Similar to | Id. | Cov. | Bits | Other hit | Other id. | Other bits |
L-arginine catabolism | artP | med | BgtA aka SLR1735, component of Arginine/lysine/histidine/glutamine porter (characterized) | 40% | 90% | 147.1 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 57% | 249.6 |
L-histidine catabolism | bgtA | med | BgtA aka SLR1735, component of Arginine/lysine/histidine/glutamine porter (characterized) | 40% | 90% | 147.1 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 57% | 249.6 |
L-lysine catabolism | hisP | med | BgtA aka SLR1735, component of Arginine/lysine/histidine/glutamine porter (characterized) | 40% | 90% | 147.1 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 57% | 249.6 |
L-asparagine catabolism | bgtA | med | ATPase (characterized, see rationale) | 40% | 80% | 145.2 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 57% | 249.6 |
L-aspartate catabolism | bgtA | med | ATPase (characterized, see rationale) | 40% | 80% | 145.2 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 57% | 249.6 |
L-histidine catabolism | Ac3H11_2560 | med | ABC transporter for L-Histidine, ATPase component (characterized) | 42% | 78% | 141.7 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 57% | 249.6 |
L-histidine catabolism | aapP | med | ABC transporter for L-Glutamine, L-Histidine, and other L-amino acids, ATPase component (characterized) | 40% | 82% | 134 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 57% | 249.6 |
D-cellobiose catabolism | gtsD | lo | Sugar ABC transporter ATP-binding protein (characterized, see rationale) | 45% | 63% | 173.7 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 57% | 249.6 |
D-glucose catabolism | gtsD | lo | Sugar ABC transporter ATP-binding protein (characterized, see rationale) | 45% | 63% | 173.7 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 57% | 249.6 |
lactose catabolism | gtsD | lo | Sugar ABC transporter ATP-binding protein (characterized, see rationale) | 45% | 63% | 173.7 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 57% | 249.6 |
D-maltose catabolism | gtsD | lo | Sugar ABC transporter ATP-binding protein (characterized, see rationale) | 45% | 63% | 173.7 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 57% | 249.6 |
sucrose catabolism | gtsD | lo | Sugar ABC transporter ATP-binding protein (characterized, see rationale) | 45% | 63% | 173.7 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 57% | 249.6 |
trehalose catabolism | gtsD | lo | Sugar ABC transporter ATP-binding protein (characterized, see rationale) | 45% | 63% | 173.7 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 57% | 249.6 |
L-asparagine catabolism | aatP | lo | Glutamate/aspartate transport ATP-binding protein GltL aka B0652, component of Glutamate/aspartate porter (characterized) | 40% | 91% | 142.1 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 57% | 249.6 |
L-aspartate catabolism | aatP | lo | Glutamate/aspartate transport ATP-binding protein GltL aka B0652, component of Glutamate/aspartate porter (characterized) | 40% | 91% | 142.1 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 57% | 249.6 |
L-glutamate catabolism | gltL | lo | Glutamate/aspartate transport ATP-binding protein GltL aka B0652, component of Glutamate/aspartate porter (characterized) | 40% | 91% | 142.1 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 57% | 249.6 |
L-fucose catabolism | SM_b21106 | lo | ABC transporter for L-Fucose, ATPase component (characterized) | 36% | 58% | 135.2 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 57% | 249.6 |
xylitol catabolism | HSERO_RS17020 | lo | ABC-type sugar transport system, ATPase component protein (characterized, see rationale) | 35% | 52% | 129.4 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 57% | 249.6 |
D-maltose catabolism | malK_Bb | lo | ABC-type maltose transport, ATP binding protein (characterized, see rationale) | 35% | 61% | 126.7 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 57% | 249.6 |
D-cellobiose catabolism | aglK' | lo | Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) | 36% | 57% | 122.1 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 57% | 249.6 |
D-glucose catabolism | aglK' | lo | Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) | 36% | 57% | 122.1 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 57% | 249.6 |
lactose catabolism | aglK' | lo | Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) | 36% | 57% | 122.1 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 57% | 249.6 |
D-maltose catabolism | aglK | lo | Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) | 36% | 57% | 122.1 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 57% | 249.6 |
D-maltose catabolism | aglK' | lo | Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) | 36% | 57% | 122.1 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 57% | 249.6 |
sucrose catabolism | aglK | lo | Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) | 36% | 57% | 122.1 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 57% | 249.6 |
sucrose catabolism | aglK' | lo | Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) | 36% | 57% | 122.1 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 57% | 249.6 |
trehalose catabolism | aglK | lo | Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) | 36% | 57% | 122.1 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 57% | 249.6 |
trehalose catabolism | aglK' | lo | Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) | 36% | 57% | 122.1 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 57% | 249.6 |
L-tryptophan catabolism | ecfA2 | lo | Energy-coupling factor transporter ATP-binding protein EcfA2; Short=ECF transporter A component EcfA2; EC 7.-.-.- (characterized, see rationale) | 38% | 78% | 120.9 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 57% | 249.6 |
D-fructose catabolism | frcA | lo | Fructose import ATP-binding protein FrcA; EC 7.5.2.- (characterized) | 31% | 83% | 83.2 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 57% | 249.6 |
D-mannose catabolism | frcA | lo | Fructose import ATP-binding protein FrcA; EC 7.5.2.- (characterized) | 31% | 83% | 83.2 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 57% | 249.6 |
D-ribose catabolism | frcA | lo | Fructose import ATP-binding protein FrcA; EC 7.5.2.- (characterized) | 31% | 83% | 83.2 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 57% | 249.6 |
sucrose catabolism | frcA | lo | Fructose import ATP-binding protein FrcA; EC 7.5.2.- (characterized) | 31% | 83% | 83.2 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 57% | 249.6 |
Sequence Analysis Tools
View 6937298 at FitnessBrowser
Find papers: PaperBLAST
Find functional residues: SitesBLAST
Search for conserved domains
Find the best match in UniProt
Compare to protein structures
Predict transmenbrane helices: Phobius
Predict protein localization: PSORTb
Find homologs in fast.genomics
Fitness BLAST: loading...
Sequence
MISLQALTKSFRMGDAEVQALRGVDIHIRQNEFVAIMGPSGSGKSTLMNIIGCLDRPTSG
NYLLNGSAVGGLSDDALSAVRNREIGFVFQSFHLLPRLSALDNVLLPLRFSETPRGDRQH
AIELLERVGLGQRLDHRPNQLSGGQRQRVAIARALVNRPTLLLADEPTGALDSKTSVEIM
ALFDELHLSGQTIVLVTHEEEVAECAGRIIRMRDGVVQQDKQKPREVSNG
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Links
Downloads
Related tools
About GapMind
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using
ublast (a fast alternative to protein BLAST)
against a database of manually-curated proteins (most of which are experimentally characterized) or by using
HMMer with enzyme models (usually from
TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
- ublast finds a hit to a characterized protein at above 40% identity and 80% coverage, and bits >= other bits+10.
- (Hits to curated proteins without experimental data as to their function are never considered high confidence.)
- HMMer finds a hit with 80% coverage of the model, and either other identity < 40 or other coverage < 0.75.
where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").
Otherwise, a candidate is "medium confidence" if either:
- ublast finds a hit at above 40% identity and 70% coverage (ignoring otherBits).
- ublast finds a hit at above 30% identity and 80% coverage, and bits >= other bits.
- HMMer finds a hit (regardless of coverage or other bits).
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps."
For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways.
For diverse bacteria and archaea that can utilize a carbon source, there is a complete
high-confidence catabolic pathway (including a transporter) just 38% of the time, and
there is a complete medium-confidence pathway 63% of the time.
Gaps may be due to:
- our ignorance of proteins' functions,
- omissions in the gene models,
- frame-shift errors in the genome sequence, or
- the organism lacks the pathway.
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory