Protein Ac3H11_2064 in Acidovorax sp. GW101-3H11
Annotation: FitnessBrowser__acidovorax_3H11:Ac3H11_2064
Length: 293 amino acids
Source: acidovorax_3H11 in FitnessBrowser
Candidate for 13 steps in catabolism of small carbon sources
| Pathway | Step | Score | Similar to | Id. | Cov. | Bits | Other hit | Other id. | Other bits |
|---|
| D-cellobiose catabolism | gtsB | hi | ABC transporter permease (characterized, see rationale) | 100% | 100% | 591.3 | ABC transporter for D-Cellobiose and D-Salicin, permease component 2 | 45% | 257.7 |
| D-glucose catabolism | gtsB | hi | ABC transporter permease (characterized, see rationale) | 100% | 100% | 591.3 | ABC transporter for D-Cellobiose and D-Salicin, permease component 2 | 45% | 257.7 |
| lactose catabolism | gtsB | hi | ABC transporter permease (characterized, see rationale) | 100% | 100% | 591.3 | ABC transporter for D-Cellobiose and D-Salicin, permease component 2 | 45% | 257.7 |
| D-maltose catabolism | gtsB | hi | ABC transporter permease (characterized, see rationale) | 100% | 100% | 591.3 | ABC transporter for D-Cellobiose and D-Salicin, permease component 2 | 45% | 257.7 |
| sucrose catabolism | gtsB | hi | ABC transporter permease (characterized, see rationale) | 100% | 100% | 591.3 | ABC transporter for D-Cellobiose and D-Salicin, permease component 2 | 45% | 257.7 |
| trehalose catabolism | gtsB | hi | ABC transporter permease (characterized, see rationale) | 100% | 100% | 591.3 | ABC transporter for D-Cellobiose and D-Salicin, permease component 2 | 45% | 257.7 |
| D-xylose catabolism | gtsB | hi | ABC transporter for D-Glucose-6-Phosphate, permease component 2 (characterized) | 62% | 96% | 407.1 | ABC transporter for D-Galactose and D-Glucose, permease component 1 | 62% | 397.1 |
| D-galactose catabolism | PfGW456L13_1895 | hi | ABC transporter for D-Galactose and D-Glucose, permease component 1 (characterized) | 62% | 96% | 397.1 | ABC transporter for D-Cellobiose and D-Salicin, permease component 2 | 45% | 257.7 |
| D-cellobiose catabolism | SMc04258 | med | ABC transporter for D-Cellobiose and D-Salicin, permease component 2 (characterized) | 45% | 93% | 257.7 | ABC transporter for D-Glucose-6-Phosphate, permease component 2 | 62% | 407.1 |
| L-arabinose catabolism | xacH | lo | Xylose/arabinose import permease protein XacH (characterized, see rationale) | 37% | 85% | 162.9 | ABC transporter for D-Glucose-6-Phosphate, permease component 2 | 62% | 407.1 |
| D-mannose catabolism | TT_C0327 | lo | Glucose transport system permease protein aka TT_C0327, component of The glucose/mannose porter TTC0326-8 plus MalK1 (ABC protein, shared with 3.A.1.1.25) (characterized) | 33% | 69% | 128.6 | ABC transporter for D-Glucose-6-Phosphate, permease component 2 | 62% | 407.1 |
| N-acetyl-D-glucosamine catabolism | SMc02872 | lo | N-Acetyl-D-glucosamine ABC transport system, permease component 1 (characterized) | 31% | 94% | 117.5 | ABC transporter for D-Glucose-6-Phosphate, permease component 2 | 62% | 407.1 |
| D-glucosamine (chitosamine) catabolism | SMc02872 | lo | N-Acetyl-D-glucosamine ABC transport system, permease component 1 (characterized) | 31% | 94% | 117.5 | ABC transporter for D-Glucose-6-Phosphate, permease component 2 | 62% | 407.1 |
Sequence Analysis Tools
View Ac3H11_2064 at FitnessBrowser
Find papers: PaperBLAST
Find functional residues: SitesBLAST
Search for conserved domains
Find the best match in UniProt
Compare to protein structures
Predict transmenbrane helices: Phobius
Predict protein localization: PSORTb
Find homologs in fast.genomics
Fitness BLAST: loading...
Sequence
MSKNTFETWLPKLVVAPAFVLGFAFIYGLMVWNGVLSLTVSRMLPNYEWAGLAQYERLWE
MDRWWVALKNLGIFGVGYVGGSLLIGVVLAVLLDQKIRAEGALRTIYLYPMALSFVVTGT
AWKWLLNPGLGIEKMVRDWGFPNFEFGWLVDTEMAIYCVVIAGIWQSAGFAMALFLAGLR
GIDDSIIKAAQVDGASLPRIYWRIVLPALRPVFFSTLMVLSHLAIKSFDLVMALTAGGPG
FATDVPATFMYTMSFSRGQIGLGAASATMMLATVAALVIPYLYSELRTKAHDR
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Links
Downloads
Related tools
About GapMind
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using
ublast (a fast alternative to protein BLAST)
against a database of manually-curated proteins (most of which are experimentally characterized) or by using
HMMer with enzyme models (usually from
TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
- ublast finds a hit to a characterized protein at above 40% identity and 80% coverage, and bits >= other bits+10.
- (Hits to curated proteins without experimental data as to their function are never considered high confidence.)
- HMMer finds a hit with 80% coverage of the model, and either other identity < 40 or other coverage < 0.75.
where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").
Otherwise, a candidate is "medium confidence" if either:
- ublast finds a hit at above 40% identity and 70% coverage (ignoring otherBits).
- ublast finds a hit at above 30% identity and 80% coverage, and bits >= other bits.
- HMMer finds a hit (regardless of coverage or other bits).
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps."
For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways.
For diverse bacteria and archaea that can utilize a carbon source, there is a complete
high-confidence catabolic pathway (including a transporter) just 38% of the time, and
there is a complete medium-confidence pathway 63% of the time.
Gaps may be due to:
- our ignorance of proteins' functions,
- omissions in the gene models,
- frame-shift errors in the genome sequence, or
- the organism lacks the pathway.
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory