GapMind for catabolism of small carbon sources

 

Protein PfGW456L13_4832 in Pseudomonas fluorescens GW456-L13

Annotation: FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_4832

Length: 838 amino acids

Source: pseudo13_GW456_L13 in FitnessBrowser

Candidate for 17 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
N-acetyl-D-glucosamine catabolism nagF hi N-acetylglucosamine-specific PTS system, I, HPr, and IIA components (nagF) (characterized) 84% 100% 1364.4 D-trehalose PTS system, I, HPr, and IIA components 45% 640.6
D-glucosamine (chitosamine) catabolism nagF hi N-acetylglucosamine-specific PTS system, I, HPr, and IIA components (nagF) (characterized) 84% 100% 1364.4 D-trehalose PTS system, I, HPr, and IIA components 45% 640.6
trehalose catabolism treEIIA med D-trehalose PTS system, I, HPr, and IIA components (characterized) 45% 98% 640.6 N-acetylglucosamine-specific PTS system, I, HPr, and IIA components (nagF) 84% 1364.4
D-fructose catabolism fruI med Fructose-specific PTS system, I, HPr, and IIA components (characterized) 41% 72% 458.8 N-acetylglucosamine-specific PTS system, I, HPr, and IIA components (nagF) 84% 1364.4
sucrose catabolism fruI med Fructose-specific PTS system, I, HPr, and IIA components (characterized) 41% 72% 458.8 N-acetylglucosamine-specific PTS system, I, HPr, and IIA components (nagF) 84% 1364.4
glycerol catabolism dhaM lo PEP-dependent dihydroxyacetone kinase, phosphoryl donor subunit DhaM; Dihydroxyacetone kinase subunit M; EC 2.7.1.121 (characterized) 31% 65% 120.2 N-acetylglucosamine-specific PTS system, I, HPr, and IIA components (nagF) 84% 1364.4
D-cellobiose catabolism crr lo PTS system glucose-specific EIIA component; EIIA-Glc; EIII-Glc; Glucose-specific phosphotransferase enzyme IIA component (characterized) 38% 87% 116.3 N-acetylglucosamine-specific PTS system, I, HPr, and IIA components (nagF) 84% 1364.4
D-glucose catabolism crr lo PTS system glucose-specific EIIA component; EIIA-Glc; EIII-Glc; Glucose-specific phosphotransferase enzyme IIA component (characterized) 38% 87% 116.3 N-acetylglucosamine-specific PTS system, I, HPr, and IIA components (nagF) 84% 1364.4
lactose catabolism crr lo PTS system glucose-specific EIIA component; EIIA-Glc; EIII-Glc; Glucose-specific phosphotransferase enzyme IIA component (characterized) 38% 87% 116.3 N-acetylglucosamine-specific PTS system, I, HPr, and IIA components (nagF) 84% 1364.4
D-maltose catabolism crr lo PTS system glucose-specific EIIA component; EIIA-Glc; EIII-Glc; Glucose-specific phosphotransferase enzyme IIA component (characterized) 38% 87% 116.3 N-acetylglucosamine-specific PTS system, I, HPr, and IIA components (nagF) 84% 1364.4
sucrose catabolism crr lo PTS system glucose-specific EIIA component; EIIA-Glc; EIII-Glc; Glucose-specific phosphotransferase enzyme IIA component (characterized) 38% 87% 116.3 N-acetylglucosamine-specific PTS system, I, HPr, and IIA components (nagF) 84% 1364.4
trehalose catabolism crr lo PTS system glucose-specific EIIA component; EIIA-Glc; EIII-Glc; Glucose-specific phosphotransferase enzyme IIA component (characterized) 38% 87% 116.3 N-acetylglucosamine-specific PTS system, I, HPr, and IIA components (nagF) 84% 1364.4
N-acetyl-D-glucosamine catabolism nagEIIA lo Putative phosphotransferase enzyme IIA component YpqE (characterized, see rationale) 35% 90% 104.8 N-acetylglucosamine-specific PTS system, I, HPr, and IIA components (nagF) 84% 1364.4
D-glucosamine (chitosamine) catabolism nagEIIA lo Putative phosphotransferase enzyme IIA component YpqE (characterized, see rationale) 35% 90% 104.8 N-acetylglucosamine-specific PTS system, I, HPr, and IIA components (nagF) 84% 1364.4
D-maltose catabolism malEIIA lo Putative phosphotransferase enzyme IIA component YpqE (characterized, see rationale) 35% 90% 104.8 N-acetylglucosamine-specific PTS system, I, HPr, and IIA components (nagF) 84% 1364.4
N-acetyl-D-glucosamine catabolism crr lo Putative PTS system sugar phosphotransferase component IIA (characterized, see rationale) 38% 97% 86.3 N-acetylglucosamine-specific PTS system, I, HPr, and IIA components (nagF) 84% 1364.4
D-glucosamine (chitosamine) catabolism crr lo Putative PTS system sugar phosphotransferase component IIA (characterized, see rationale) 38% 97% 86.3 N-acetylglucosamine-specific PTS system, I, HPr, and IIA components (nagF) 84% 1364.4

Sequence Analysis Tools

View PfGW456L13_4832 at FitnessBrowser

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MHNNNKELTLSAPLSGPVLTLAKVPDAVFASGAMGDGIAIDPLNDTLHAPCAGVVVHVAR
TGHAVTLRADNGAELLLHLGLDTVELQGQGFSMLVKEGARVSNGQPLLRYDLDKVAQQCK
SLVSLLILTNSQDFQARPITLKSVKVGEPLLHIIRRQGVGAQADVELAGEEVVGHIRIAH
RGGLHARPAALIRQTAQGFKSKSQLHFAGKSATCDSLIGLMGLAIGEQAEVQVSCQGPDA
EAALQALLTALSTALAEDSHAAAPTTIAQRNRPAEAGVLHGVCAAPGLVGGPLFHLNAIS
LPVDAGHHDPQQQQQVLDAALSQVRSEIERTLVLAKKHKDTAEEAIFAAHLALLEDPALL
DAAIQTVAQGTAATHAWSQAIDVQCEVLQQTGSTLLAERANDLRDLKQRVLRALLGDTWH
YDVPAGAIVAAHELTPSDLLQLSQQGVAGLCMAEGGATSHVAILARGKGLPCMVALGSTL
LDQQQGQPVVLDADGGRLELTPSAERLADVRQLQQQQQQRRAEQQAQAHTPALTTDGLRI
EVAANVASSTEAADALANGADGVGLLRTEFLFVDRHTAPDEQEQHHAYQAVLDAMGDKSV
IIRTIDVGGDKQLDYLPLPAEANPVLGLRGIRLAQARPELLDQQLRALLHLRPLSRCRIL
LPMVTEVDELLHIHQRLDALCGELGLAQRPELGVMIEVPAAALLAEQLAEHADFLSIGTN
DLSQYTLAMDRDHAGLAARVDALHPALLRLIAQTCAGAAQHNRWVGVCGALASDPLATPV
LIGLGVSELSVSPVQVGEIKDRVRHLDASECRRISQGLLKLSSASAVRHACHQHWPLS

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory